KEGG   Taeniopygia guttata (zebra finch): 100223487Help
Entry
100223487         CDS       T01082                                 

Gene name
HDAC11
Definition
(RefSeq) histone deacetylase 11
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100223487 (HDAC11)
Chromosome [BR:tgu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     100223487 (HDAC11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 330 aa AA seqDB search
MGLEKLHPFDAGKWGKVINFLKEEKLIADDLIVQAREATDEDLLVVHTRRYLNKLKWSFV
VATITEIPPVAFLPNFIVQRKVLKPLRTQTGGTIMAGKLAVDRGWAINVGGGFHHCSSDK
GGGFCAYADITLAIKFLFERVQGVSRATIIDLDAHQGNGHERDFMDDPRVYIMDAYNRYI
YPGDGFAKRAIKRKVELEWGTEDTEYLQKVHTHVEGALNEFKPDIVVYNAGTDVLDGDPL
GGLAISPQVGIVKRDEVVWFQGHRSPGVPVLMVTSGGYQKRTARIIADSILNLHGLGLLG
RERPARAPGSPSLGPLLTDSAKDLSNLSLQ
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgggacttgagaagctgcacccctttgatgcagggaaatgggggaaagtcatcaatttt
ttgaaagaagaaaaactaattgcagatgacttgattgtgcaggcacgggaggctactgat
gaagatctcttggttgttcacaccaggcgctaccttaataaattaaagtggtcatttgtt
gtggctacaatcacagaaattccaccagttgcctttcttcccaatttcattgttcagaga
aaagttctgaaacctctacgaacccagacaggaggaacaataatggcaggaaagcttgct
gtggatagaggctgggccatcaatgtggggggtggtttccatcactgctccagtgacaaa
gggggaggattttgtgcatatgctgacatcacactggccatcaagttcttatttgagaga
gtacaaggagtgtctagagccacaattattgatctggatgcccatcagggaaatggccat
gagagggactttatggatgatcctcgggtttatattatggatgcatacaatagatatatt
tacccaggtgatggttttgctaaacgtgccataaaacgcaaagtggaactggagtggggc
acagaggacaccgagtacctgcagaaggtgcacacccacgtggagggagccctgaatgaa
ttcaagcctgacatcgttgtttacaatgctggcacggacgttctggacggggatcccctg
ggaggcctggccatttccccccaggtaggcattgtgaagagggacgaggtggtgtggttt
cagggtcacaggagccccggggtgcctgtgctgatggtgacgtccggcgggtaccagaag
aggacggcgcggatcatcgccgactccatcctcaacctgcacggcctggggctcctgggc
agggagcgcccagcccgggctcctggcagccccagcctgggccccctgctcacagactct
gccaaggacttgagcaacttgtccctgcagtga

DBGET integrated database retrieval system