KEGG   Taeniopygia guttata (zebra finch): 100223519Help
Entry
100223519         CDS       T01082                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
tgu04012  ErbB signaling pathway
tgu04068  FoxO signaling pathway
tgu04137  Mitophagy - animal
tgu04140  Autophagy - animal
tgu04141  Protein processing in endoplasmic reticulum
tgu04210  Apoptosis
tgu04217  Necroptosis
tgu04310  Wnt signaling pathway
tgu04510  Focal adhesion
tgu04530  Tight junction
tgu04620  Toll-like receptor signaling pathway
tgu04621  NOD-like receptor signaling pathway
tgu04622  RIG-I-like receptor signaling pathway
tgu04625  C-type lectin receptor signaling pathway
tgu04910  Insulin signaling pathway
tgu04912  GnRH signaling pathway
tgu04914  Progesterone-mediated oocyte maturation
tgu04920  Adipocytokine signaling pathway
tgu04933  AGE-RAGE signaling pathway in diabetic complications
tgu05132  Salmonella infection
tgu05164  Influenza A
tgu05168  Herpes simplex infection
Module
tgu_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100223519 (MAPK10)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100223519 (MAPK10)
   04012 ErbB signaling pathway
    100223519 (MAPK10)
   04310 Wnt signaling pathway
    100223519 (MAPK10)
   04068 FoxO signaling pathway
    100223519 (MAPK10)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100223519 (MAPK10)
   04137 Mitophagy - animal
    100223519 (MAPK10)
  Cell growth and death
   04210 Apoptosis
    100223519 (MAPK10)
   04217 Necroptosis
    100223519 (MAPK10)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100223519 (MAPK10)
   04530 Tight junction
    100223519 (MAPK10)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100223519 (MAPK10)
   04621 NOD-like receptor signaling pathway
    100223519 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    100223519 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    100223519 (MAPK10)
  Endocrine system
   04910 Insulin signaling pathway
    100223519 (MAPK10)
   04920 Adipocytokine signaling pathway
    100223519 (MAPK10)
   04912 GnRH signaling pathway
    100223519 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    100223519 (MAPK10)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100223519 (MAPK10)
  Infectious diseases
   05132 Salmonella infection
    100223519 (MAPK10)
   05164 Influenza A
    100223519 (MAPK10)
   05168 Herpes simplex infection
    100223519 (MAPK10)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100223519 (MAPK10)
Protein kinases [BR:tgu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100223519 (MAPK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2
Motif
Other DBs
NCBI-GeneID: 100223519
NCBI-ProteinID: XP_002189300
Ensembl: ENSTGUG00000002750
Position
4
AA seq 485 aa AA seqDB search
MHEVDAFELFPIDETAHAVVFMSRHFLYYFGEPTLDVKIAFCQGFGKQVDVSYIAKHYNM
SKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPF
QNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQM
ELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFM
MTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQL
GTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKM
LVIDPAKRISVDEALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVM
NSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGP
LGCCR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaagttgatgcctttgaactatttcctatagatgagacagcacatgctgtggta
tttatgagccgccatttcctgtattattttggtgaacctactctggatgtgaagattgcc
ttttgtcagggatttgggaaacaagtggatgtgtcatatattgccaaacattacaacatg
agcaaaagcaaagtcgacaaccagttctacagtgtggaagtaggtgactcgaccttcaca
gtcctcaaacgctaccagaacttgaaacctattggctctggggctcagggaatagtttgt
gctgcatatgatgccgtccttgacagaaatgtggccattaagaagctcagcagaccattt
cagaaccaaactcacgccaagagagcttacagggagctggtcctcatgaagtgtgtgaat
cataaaaatattataagtttattaaatgtcttcacaccacagaaatctctggaggagttc
caggatgtctacctagtaatggaattaatggatgccaacctgtgccaggtcattcagatg
gagctggaccatgagcgaatgtcttaccttctgtaccaaatgctctgtggaatcaagcat
cttcactctgcagggattattcacagggatttaaaaccaagtaacattgtagtaaaatct
gactgcacgttgaagattctggattttggactggccaggactgcaggcactagcttcatg
atgaccccctatgtggtgacacgctactacagagcaccagaggtcatcctgggaatgggt
tacaaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccac
aaaatcctctttccaggaagggactatattgatcagtggaataaagttattgagcagctg
ggaacaccctgtccagaattcatgaagaagctgcagccaacagtacggaactatgttgag
aacagacccaagtatgctggcctcactttccccaaactttttccagactctctcttccca
gcagactcggaacacaacaaactcaaagccagccaagccagggacctcttatcaaagatg
ctggtcattgatccggccaagaggatatcagtagatgaagccttacagcatccatacatt
aatgtctggtacgacccagcagaggtggaggcgcctcctcctcagatatatgataaacag
ctggatgaaagggaacatacaattgaggaatggaaagaactcatctacaaagaagtaatg
aattctgaagaaaagactaaaaatggagtagtaaaaggacagccttctccttcaggtgca
gcagtgaacagcagtgagagcctccctccatcctcatctgtcaacgacatctcatccatg
tccacggatcaaaccctggcgtctgacacggacagcagcctggaagcttctgcgggaccc
ctcggttgttgcaggtga

DBGET integrated database retrieval system