KEGG   Taeniopygia guttata (zebra finch): 100223523Help
Entry
100223523         CDS       T01082                                 

Gene name
THBS4
Definition
thrombospondin 4
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:tgu04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:tgu04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:tgu04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Z
AA seq 1052 aa AA seqDB search
MGRGRNGQLTERVNTANKNKLRTLDRPPPRPPPASGGGAPANGPAPAAGRARPRGRPVKR
RGAVCRGGRASPPCPVRERHGGVQTSARRREPCLAAERSALQVLGEPPLPVGAQSAPAEP
PGLAERDGVFDLLPYSNKRVVLNFLQQAFGDPMLNEVYLLSTFKLQPKSTATVFGLYSSA
DNSKYFEFTVMGRMSKAVLRYLKSDGRLNSVIFSNIQLADGKPHAVILWLSGLQQGLSTV
ELYLDCLQVGAIEDLPKPFSALSQKVVSAELRTLQEKPQDTLDELKLVTGGTLAEVGNLQ
DCFLQQIEAVPQYTGDFNRQLMGQMMQMNQLLGDVKDLLRQQVKETTFLRNTIAECQACG
LGTVSFPTQLPRRTKPKCEVNSCFRGVRCMETAEGFQCGPCPEGLTGNGVTCSDIDECRY
NPCFPGVRCVNTAPGFRCETCPPGYTGQAVQGIGLSYAKNNKQVCLDIDECQNGGLGLCV
PNSHCINTLGSYQCGHCKPGYTGDQTRGCQAERSCRNQALNPCSIHARCIEEKRGEVTCT
CGIGWAGDGYICGKDVDIDGYPNEELSCSAENCRKDNCRFVPNSGQEDADGDGIGDACDD
DADGDGIPNEQDNCVLVPNVNQRNSDQDIFGDACDNCRNVLNNDQRDTDGDGKGDACDDD
MDGDGIKNLLDNCQRIPNEDQEDTDNDGVGDACDSCPTISNPNQSDVDNDLVGDSCDTNQ
DSDGDGHQDSTDNCPTVINSSQLDTDKDGLGDECDDDDDNDGIPDLLPPGPDNCRLVPNL
GQEDDNGDGVGDVCESDFDQDTVIDRIDVCPENAEITLTDFRAYQTVVLDPEGDAQIDPN
WVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFY
VVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTNDQVRLLWKD
PRNVGWKDKVSYRWFLQHRPQIGYIRARFYEGSDLVADSGVTIDTTMRGGRLGVFCFSQE
NIIWSNLKYRCNDTIPEDFQEFQAQQFGVGDI
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atgggcagaggaagaaacgggcaacttacggagagggtcaacactgctaacaagaataag
ctaagaacgctcgaccgtccccctccgcggcccccgcccgcctccggagggggagccccg
gccaatggcccggcgcctgccgccggccgtgcccggccccggggccgccccgttaaacgg
cggggcgcggtgtgccgcggcggccgtgcctcgccgccttgcccggtccgcgaacgacat
gggggtgtccagacctccgcccgccgccgggagccctgcctggcagcggaacggagcgct
ctgcaggtgctgggggagccgccgctgcccgtcggggcgcagagcgcgcccgcggagccg
cccggactagcggagagagatggcgtttttgatcttcttccttattccaacaagcgagta
gtacttaacttcttgcaacaagcatttggggatcctatgctgaatgaagtgtacttgctc
tcaacattcaaattacagccaaagagcacggccactgtttttggcctatattcatcagct
gacaacagcaagtattttgaatttacggtaatgggacggatgagtaaagcggtgctgcgc
tatctgaagagtgatggaaggctgaattctgtgatctttagcaacatccagctggctgat
gggaaaccccatgctgtcatcttgtggctgagtggcctgcagcagggattgagcacagta
gagttgtatctggactgcctgcaagtaggtgccattgaggacttgccaaaaccattttca
gcactgtctcagaaggtggtgtcagctgagttgcgcactctccaggaaaagccacaggat
acactagatgagctaaagctggtaactggaggaacccttgctgaagtgggaaacctgcag
gattgttttcttcaacaaattgaggctgtacctcagtacactggtgattttaataggcag
ctgatgggtcaaatgatgcagatgaaccaactactgggagatgtgaaagaccttcttaga
caacaggtcaaagaaacaacttttctgagaaataccatagctgagtgccaagcatgtggt
ttaggcactgtgagttttccaactcagcttcctaggcgcactaaaccgaaatgtgaagtt
aattcctgcttcaggggagtgaggtgcatggagacagcagagggatttcagtgtgggccc
tgcccggaaggactcacgggaaatggagttacatgctcagatattgatgagtgtcgttac
aacccttgcttccctggtgtgcgatgtgtgaacactgctccaggtttccgatgtgagacc
tgtcctccaggatatacgggacaagctgtgcaagggataggactcagctatgccaagaac
aataagcaggtctgcttagatattgatgaatgtcagaatggaggacttggactctgtgtt
ccgaactcccattgcataaacactttggggtcttaccagtgtggccattgcaaaccagga
tatacaggagaccaaaccaggggatgccaggctgaacggagctgtaggaatcaagccctc
aatccatgcagcatccatgcccgatgtattgaggagaagagaggagaggtgacatgtact
tgtggcattggctgggctggtgatggttatatttgtggaaaagatgttgacattgatggc
taccctaatgaagaactgtcatgctctgctgaaaactgcagaaaggacaattgcagattt
gttccaaactctggacaagaagatgctgatggtgatgggatcggagatgcctgtgatgac
gatgcagatggagatggcattcccaatgagcaggataactgtgtcttggttcctaatgtt
aaccagagaaacagtgaccaagatatctttggagatgcttgtgacaactgccgtaatgtc
ctgaataatgaccagagggacacagatggtgatgggaaaggagatgcatgtgatgatgac
atggatggagatggtattaagaaccttttggataattgtcagaggatccccaatgaagac
caggaggacacagataatgacggtgttggtgatgcctgtgacagctgccctacaatcagc
aacccaaaccagtcagatgtcgacaatgacctggttggagattcctgtgataccaatcag
gacagcgatggtgatgggcaccaggacagcacagacaattgccctacagttattaacagc
tcccagctggacacagataaggatgggctgggtgatgagtgtgatgatgatgatgataat
gatggcattcctgacctcttgcctccgggccctgacaactgcaggctggtccccaacctg
gggcaggaagatgataatggtgatggagttggcgatgtctgtgagtctgattttgaccag
gacacagtgattgatcggattgatgtgtgccctgagaatgcagagatcaccttgacagac
ttcagggcctatcagacagtggtgttggacccagagggggatgcgcagattgatcccaac
tgggtggttctgaaccaggggatggaaattgtgcagactatgaacagtgatcctggcctt
gctgttggttacacggcttttaacggcgttgactttgagggcacttttcatgtgaacaca
gtgacagatgacgactatgctggctttatttttggttatcaagacagctctagcttttac
gtagtaatgtggaaacagacggaacagacatactggcaagcgactcccttccgagctgtt
gcagagcccggcattcagctaaaggctgtgaaatccaagacaggtcctggtgagcacctc
cgcaactccctctggcacacaggggacaccaatgatcaggtcaggctgctgtggaaggac
ccccgaaatgtagggtggaaagacaaagtctcctatcgctggttcttgcagcacagacct
cagattggttatatcagggcaagattttatgaaggctctgacctagtggcagattctggt
gtaaccatagacaccacgatgcgtggaggacggcttggagttttctgcttctctcaggaa
aacattatttggtccaacctgaaatatcgctgcaatgacaccatcccagaggactttcaa
gaatttcaagcgcagcaatttggtgttggggatatttaa

DBGET integrated database retrieval system