KEGG   Taeniopygia guttata (zebra finch): 100223523Help
Entry
100223523         CDS       T01082                                 

Gene name
THBS4
Definition
(RefSeq) thrombospondin 4
  KO
K04659  
thrombospondin 2/3/4/5
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100223523 (THBS4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100223523 (THBS4)
  Cellular commiunity
   04510 Focal adhesion
    100223523 (THBS4)
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100223523 (THBS4)
  Exosomal proteins of colorectal cancer cells
   100223523 (THBS4)
  Exosomal proteins of bladder cancer cells
   100223523 (THBS4)
Glycosaminoglycan binding proteins [BR:tgu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100223523 (THBS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Z
AA seq 862 aa AA seqDB search
MGRMSKAVLRYLKSDGRLNSVIFSNIQLADGKPHAVILWLSGLQQGLSTVELYLDCLQVG
AIEDLPKPFSALSQKVVSAELRTLQEKPQDTLDELKLVTGGTLAEVGNLQDCFLQQIEAV
PQYTGDFNRQLMGQMMQMNQLLGDVKDLLRQQVKETTFLRNTIAECQACGLGTVSFPTQL
PRRTKPKCEVNSCFRGVRCMETAEGFQCGPCPEGLTGNGVTCSDIDECRYNPCFPGVRCV
NTAPGFRCETCPPGYTGQAVQGIGLSYAKNNKQVCLDIDECQNGGLGLCVPNSHCINTLG
SYQCGHCKPGYTGDQTRGCQAERSCRNQALNPCSIHARCIEEKRGEVTCTCGIGWAGDGY
ICGKDVDIDGYPNEELSCSAENCRKDNCRFVPNSGQEDADGDGIGDACDDDADGDGIPNE
QDNCVLVPNVNQRNSDQDIFGDACDNCRNVLNNDQRDTDGDGKGDACDDDMDGDGIKNLL
DNCQRIPNEDQEDTDNDGVGDACDSCPTISNPNQSDVDNDLVGDSCDTNQDSDGDGHQDS
TDNCPTVINSSQLDTDKDGLGDECDDDDDNDGIPDLLPPGPDNCRLVPNLGQEDDNGDGV
GDVCESDFDQDTVIDRIDVCPENAEITLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEI
VQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQTEQT
YWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTNDQVRLLWKDPRNVGWKDKV
SYRWFLQHRPQIGYIRARFYEGSDLVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYR
CNDTIPEDFQEFQAQQFGVGDI
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgggacggatgagtaaagcggtgctgcgctatctgaagagtgatggaaggctgaattct
gtgatctttagcaacatccagctggctgatgggaaaccccatgctgtcatcttgtggctg
agtggcctgcagcagggattgagcacagtagagttgtatctggactgcctgcaagtaggt
gccattgaggacttgccaaaaccattttcagcactgtctcagaaggtggtgtcagctgag
ttgcgcactctccaggaaaagccacaggatacactagatgagctaaagctggtaactgga
ggaacccttgctgaagtgggaaacctgcaggattgttttcttcaacaaattgaggctgta
cctcagtacactggtgattttaataggcagctgatgggtcaaatgatgcagatgaaccaa
ctactgggagatgtgaaagaccttcttagacaacaggtcaaagaaacaacttttctgaga
aataccatagctgagtgccaagcatgtggtttaggcactgtgagttttccaactcagctt
cctaggcgcactaaaccgaaatgtgaagttaattcctgcttcaggggagtgaggtgcatg
gagacagcagagggatttcagtgtgggccctgcccggaaggactcacgggaaatggagtt
acatgctcagatattgatgagtgtcgttacaacccttgcttccctggtgtgcgatgtgtg
aacactgctccaggtttccgatgtgagacctgtcctccaggatatacgggacaagctgtg
caagggataggactcagctatgccaagaacaataagcaggtctgcttagatattgatgaa
tgtcagaatggaggacttggactctgtgttccgaactcccattgcataaacactttgggg
tcttaccagtgtggccattgcaaaccaggatatacaggagaccaaaccaggggatgccag
gctgaacggagctgtaggaatcaagccctcaatccatgcagcatccatgcccgatgtatt
gaggagaagagaggagaggtgacatgtacttgtggcattggctgggctggtgatggttat
atttgtggaaaagatgttgacattgatggctaccctaatgaagaactgtcatgctctgct
gaaaactgcagaaaggacaattgcagatttgttccaaactctggacaagaagatgctgat
ggtgatgggatcggagatgcctgtgatgacgatgcagatggagatggcattcccaatgag
caggataactgtgtcttggttcctaatgttaaccagagaaacagtgaccaagatatcttt
ggagatgcttgtgacaactgccgtaatgtcctgaataatgaccagagggacacagatggt
gatgggaaaggagatgcatgtgatgatgacatggatggagatggtattaagaaccttttg
gataattgtcagaggatccccaatgaagaccaggaggacacagataatgacggtgttggt
gatgcctgtgacagctgccctacaatcagcaacccaaaccagtcagatgtcgacaatgac
ctggttggagattcctgtgataccaatcaggacagcgatggtgatgggcaccaggacagc
acagacaattgccctacagttattaacagctcccagctggacacagataaggatgggctg
ggtgatgagtgtgatgatgatgatgataatgatggcattcctgacctcttgcctccgggc
cctgacaactgcaggctggtccccaacctggggcaggaagatgataatggtgatggagtt
ggcgatgtctgtgagtctgattttgaccaggacacagtgattgatcggattgatgtgtgc
cctgagaatgcagagatcaccttgacagacttcagggcctatcagacagtggtgttggac
ccagagggggatgcgcagattgatcccaactgggtggttctgaaccaggggatggaaatt
gtgcagactatgaacagtgatcctggccttgctgttggttacacggcttttaacggcgtt
gactttgagggcacttttcatgtgaacacagtgacagatgacgactatgctggctttatt
tttggttatcaagacagctctagcttttacgtagtaatgtggaaacagacggaacagaca
tactggcaagcgactcccttccgagctgttgcagagcccggcattcagctaaaggctgtg
aaatccaagacaggtcctggtgagcacctccgcaactccctctggcacacaggggacacc
aatgatcaggtcaggctgctgtggaaggacccccgaaatgtagggtggaaagacaaagtc
tcctatcgctggttcttgcagcacagacctcagattggttatatcagggcaagattttat
gaaggctctgacctagtggcagattctggtgtaaccatagacaccacgatgcgtggagga
cggcttggagttttctgcttctctcaggaaaacattatttggtccaacctgaaatatcgc
tgcaatgacaccatcccagaggactttcaagaatttcaagcgcagcaatttggtgttggg
gatatttaa

DBGET integrated database retrieval system