KEGG   Taeniopygia guttata (zebra finch): 100223555Help
Entry
100223555         CDS       T01082                                 

Gene name
CYCS
Definition
cytochrome c, somatic
Orthology
K08738  
cytochrome c
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Sulfur metabolism
p53 signaling pathway
Apoptosis
Influenza A
Herpes simplex infection
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:tgu00920]
Cellular Processes; Cell growth and death; Apoptosis [PATH:tgu04210]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:tgu04115]
Human Diseases; Infectious diseases; Influenza A [PATH:tgu05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:tgu05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCSQCHTVEKGGKHKTGPNLNGLFGRKTGQAEGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKVATAK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgttgagaagggcaagaagatctttgtccagaaatgctcccagtgccacacg
gttgaaaagggaggcaagcataagactgggcccaacttgaatggcctattcggacgcaag
actgggcaagctgaaggtttctcttacacggatgctaataagaacaaaggtatcacctgg
ggtgaggatactctgatggagtatttggaaaatccaaagaagtatattcctggaacaaag
atgatttttgcgggtattaagaagaagggcgagagagcagacttaatagcatacctcaaa
gttgccactgcaaagtaa

DBGET integrated database retrieval system