KEGG   Taeniopygia guttata (zebra finch): 100223686Help
Entry
100223686         CDS       T01082                                 

Definition
cell division cycle protein 27 homolog
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100223686
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100223686
   04114 Oocyte meiosis
    100223686
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100223686
Protein phosphatases and associated proteins [BR:tgu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100223686
Ubiquitin system [BR:tgu04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     100223686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
27
AA seq 833 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVLNKQKSHDDIVMEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCL
PNTCTTVVSNHNISHRQPESVLMETPQDTIELNRINLESSNSKYSSLNSDSSMSYIDSAV
ISSDSVPLGSGTAILSKQAQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQ
NYTNSSSVIDVPSTGAPSKKTVSRISQAGTKSVFSQSGNSREVTPVLVAQTQSSGPQTST
TPQVLSPTIAAPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGI
TQPNLNDSLEITKLDSSIISEGKISTVAPQIQAFTLQKAAAGLMSLLRDMGKGYLALCSY
NCKEAINILSHLPSHHYNTGWVLCQIGRAYFELAEYMQAERIFSEVRRIENYRVEGMEIY
STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPN
YAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQ
KALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAINIDPKNPLCKFHRASVLFANEKY
KSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI
DKRYLPDDEEPITREEQISECYPYESVGTDESQESSMTDADDTQLHAVESDEF
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatctggcaagcactgaaccactacgcg
tatcgcgatgccgtgttcctcgcagaaaggttatatgcagaagtacactcagaagaagca
ctgtttttactggcaacgtgttactaccgctcaggaaaggcctacaaagcttacaggctc
ctaaagggacacagctgtaccaccccacagtgtaaatacctgcttgcaaaatgttgtgtg
gacctcagcaagcttgcagaaggagagcagatcttgtctggtggagtgttgaataaacag
aaaagccatgatgacattgttatggagtttggtgactctgcatgctttacactctcctta
ctgggacatgtctactgcaagacggaccggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtccccttttgaatcactatgtgaaataggtgaa
aagccagaccctgaccaaacatttaaattaacatccttacagaacttcagcagctgtctg
cccaacacttgcacaacagtggtgtctaatcacaacatatcccacagacagcctgagagt
gtcctcatggagacaccccaggacacaattgagttgaacagaatcaacctagaatcctcc
aattcaaagtattcctccttgaattcggattcttctatgtcttacattgactctgctgtg
atttcctcggattctgtccccctggggtcaggaactgccatattgtccaaacaggctcaa
aataaaccaaaaactggacggagtttactggggggacctgcagctttgagcccactaact
ccaagctttggaattttgccactggaaaccccgagccctggagatggatcctatttacag
aactacaccaactcctcctctgtaattgatgtgccatccaccggagcaccttcaaagaag
actgtcagcaggatcagccaggctggaacaaaatccgtcttctcccagagtgggaatagc
cgggaagtcactccagttcttgttgcacaaacacagagctctggtccacagacaagtaca
acacctcaggtattgagcccaaccattgctgctccacccaacgcgctgcctcgacgaagc
tctcgcctgttcaccagtgatagttccacaaccaaggaaaatagcaaaaaattaaaaatg
aagtttccacctaagattccaaacagaaaaacaaaaagtaaaacaaataagggaggaata
actcaaccaaacttaaatgacagtttggaaattaccaaactggactcttccatcatttca
gaagggaaaatttccactgttgcaccacaaatccaagctttcacgctacagaaggcagca
gcaggtttgatgagccttctccgggacatggggaaaggttatttagccttgtgctcatac
aactgcaaagaagccatcaatattttgagccatttgccatcccaccactacaacacaggc
tgggtgctgtgccaaattgggagagcttactttgagctggcagaatacatgcaggctgag
cgaatattttcagaagtgaggaggattgaaaactacagagtggaaggcatggaaatctat
tcaaccacactctggcatctgcagaaagatgttgccctttcagtcctttctaaggatttg
acagacatggataaaaactcaccagaggcctggtgtgctgcagggaactgcttcagcttg
cagagggagcacgacattgccatcaagttcttccagagggccatccaggtggatccaaac
tacgcctatgcctacaccctgctgggccacgagtttgtgttgacagaagagctggacaag
gcgttggcctgtttcaggaatgccatcagagttaacccccggcactacaacgcctggtac
gggttgggaatgatttattacaagcaggagaagttcagtctggcagaaatgcatttccag
aaagcacttgatatcaaccctcagagctcagtcctgctgtgtcacattggagtagtccaa
catgcactgaaaaaatctgagaaggctttggacaccttgaacaaagcgatcaacatcgac
cccaagaacccactatgcaaattccacagagcctcggtgttatttgcaaacgagaagtac
aagtcggctttacaagaacttgaagaactgaaacagattgttcccaaagagtctcttgtt
tactttttaataggaaaggtttataaaaagctgggtcagacgcatctggccctaatgaat
ttctcctgggcaatggacctggatcccaaaggagccaacaaccagatcaaggaggccata
gacaagcgctacctgcccgatgacgaggagcccatcacccgcgaggagcagatcagcgag
tgctacccctacgagtcagtgggcacagacgagtcccaggagagcagcatgacggatgcg
gatgacacgcagctccacgccgtggaaagcgatgaattttaa

DBGET integrated database retrieval system