KEGG   Taeniopygia guttata (zebra finch): 100223817Help
Entry
100223817         CDS       T01082                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100223817 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100223817 (LPL)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     100223817 (LPL)
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100223817 (LPL)
  Exosomal proteins of breast milk
   100223817 (LPL)
Glycosaminoglycan binding proteins [BR:tgu00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   100223817 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Z
AA seq 521 aa AA seqDB search
MGGLGEALPAWREKGVCNLSFVKLSREFGMLRDPGFAEGDPETWSLVPSRNSGTACRAAE
GKNNFEGIESKFSLRTPAEPDEDVCYLVPGQVNSLARCNFNHTSKTFVVIHGWTVTGMYE
SWVPKLVDALYKREPDSNVIVVDWLVRAQEHYPVSAAYTRLVGKDVATFIDWMEEEFNYP
LNKLHLLGYSLGAHAAGIAGNLTKKKVNRITGLDPAGPTFEYADEVTRLSPDDAEFVDVL
HTYTRGSPDRSIGIQKPVGHIDIYPNGGGFQPGCNLGEALRLIAEKGLGDVDQLVKCSHE
RSIHLFIDSLLNEEKPSMAYRCNTKEAFEKGLCLSCRKNRCNNLGYKVNRVRTKRNTKMY
LKTRAQMPYKVFHYQVKIHFFGKTNMTKTNQPFLISLYGTLDESENIGFTLPEVSSNKTF
SFLIYTEVDIGDLLMVKLQWEKDTFFSWSDWWTPFTFDIQRIRMKSGETQKKVVFCSRDG
TSRLSKGEEAAIFVKCSEQPANRKRGGTKKASKENSAHESA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggggggcttgggggaagcgctgccggcgtggcgggaaaagggagtttgcaatctttcc
tttgtgaagctgtcccgggagttcgggatgctgcgggacccgggtttcgcggagggcgac
cctgagacctggagcctggtccccagccgaaactcaggcacagcttgccgggctgcagaa
ggcaaaaacaattttgagggaatcgagagcaagttttccttacggacacctgcagagccc
gatgaggatgtctgctacctggttcctgggcaggtgaacagcctggcacggtgcaacttc
aatcacaccagtaaaacctttgtggtgatccatgggtggacggtgacagggatgtatgaa
agctgggtcccgaagctggtggatgctctgtacaagagggagccagactcaaatgtcatc
gtggtggactggctggttcgagctcaggagcactacccggtgtcggctgcgtacaccagg
ctggtgggaaaggatgttgccacttttattgactggatggaggaggaattcaattatccc
ctcaacaagctccacttgctggggtacagtctaggtgctcatgctgctgggattgctggg
aatctgaccaaaaagaaggtgaacagaattactgggctggatcctgctggtcctaccttt
gagtatgctgatgaagtcacccgcctctccccggatgatgctgagtttgtggatgtccta
cacacctacacccgaggctctccagaccgcagcattgggatccagaagcctgttggacat
attgatatttatcccaatggtggaggtttccagccaggctgcaatttgggagaagcactg
cgtctgattgctgagaaagggcttggagatgtggatcagctggtgaaatgctcccatgag
cgatccatccacctcttcattgactctctcctcaacgaagaaaagccaagcatggcctac
cgctgcaacacaaaggaggcctttgagaagggcctctgcctcagctgccgcaagaaccgc
tgcaacaatctgggttacaaggtcaacagagtgagaacaaagagaaacaccaaaatgtat
ctgaaaacccgtgctcagatgccctacaaagtttttcattaccaggtcaagatccatttc
tttggaaagactaacatgaccaagacaaaccagccattcctgatctctctctatggcacc
ctagatgagagtgagaacattggtttcacgctgcctgaagtctcctcaaacaagaccttc
tccttcttgatttacacagaagtggatattggagacctgcttatggtgaagctgcagtgg
gaaaaagacaccttcttcagctggtcagactggtggactccttttacatttgacatccag
agaatcagaatgaagtcaggggaaactcagaaaaaagtggtgttctgctctcgagatggc
acttcgcgtctcagcaagggagaagaggcagcaatatttgtgaaatgctcggagcagccc
gccaacaggaagagaggaggtaccaagaaagcctcgaaagaaaattctgctcatgaatct
gcttaa

DBGET integrated database retrieval system