KEGG   Taeniopygia guttata (zebra finch): 100223817Help
Entry
100223817         CDS       T01082                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100223817
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100223817
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     100223817
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100223817
  Exosomal proteins of breast milk
   100223817
Heparan sulfate/heparin binding proteins [BR:tgu00536]
 Enzymes (General comment) Variety
  100223817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Z
AA seq 482 aa AA seqDB search
MWRKALLAAVCLCLRWAALGEGKNNFEGIESKFSLRTPAEPDEDVCYLVPGQVNSLARCN
FNHTSKTFVVIHGWTVTGMYESWVPKLVDALYKREPDSNVIVVDWLVRAQEHYPVSAAYT
RLVGKDVATFIDWMEEEFNYPLNKLHLLGYSLGAHAAGIAGNLTKKKVNRITGLDPAGPT
FEYADEVTRLSPDDAEFVDVLHTYTRGSPDRSIGIQKPVGHIDIYPNGGGFQPGCNLGEA
LRLIAEKGLGDVDQLVKCSHERSIHLFIDSLLNEEKPSMAYRCNTKEAFEKGLCLSCRKN
RCNNLGYKVNRVRTKRNTKMYLKTRAQMPYKVFHYQVKIHFFGKTNMTKTNQPFLISLYG
TLDESENIGFTLPEVSSNKTFSFLIYTEVDIGDLLMVKLQWEKDTFFSWSDWWTPFTFDI
QRIRMKSGETQKKVVFCSRDGTSRLSKGEEAAIFVKCSEQPANRKRGGTKKASKENSAHE
SA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtggaggaaggcgctcctggccgccgtgtgcctctgcctgcgctgggcggctctgggc
gaaggcaaaaacaattttgagggaatcgagagcaagttttccttacggacacctgcagag
cccgatgaggatgtctgctacctggttcctgggcaggtgaacagcctggcacggtgcaac
ttcaatcacaccagtaaaacctttgtggtgatccatgggtggacggtgacagggatgtat
gaaagctgggtcccgaagctggtggatgctctgtacaagagggagccagactcaaatgtc
atcgtggtggactggctggttcgagctcaggagcactacccggtgtcggctgcgtacacc
aggctggtgggaaaggatgttgccacttttattgactggatggaggaggaattcaattat
cccctcaacaagctccacttgctggggtacagtctaggtgctcatgctgctgggattgct
gggaatctgaccaaaaagaaggtgaacagaattactgggctggatcctgctggtcctacc
tttgagtatgctgatgaagtcacccgcctctccccggatgatgctgagtttgtggatgtc
ctacacacctacacccgaggctctccagaccgcagcattgggatccagaagcctgttgga
catattgatatttatcccaatggtggaggtttccagccaggctgcaatttgggagaagca
ctgcgtctgattgctgagaaagggcttggagatgtggatcagctggtgaaatgctcccat
gagcgatccatccacctcttcattgactctctcctcaacgaagaaaagccaagcatggcc
taccgctgcaacacaaaggaggcctttgagaagggcctctgcctcagctgccgcaagaac
cgctgcaacaatctgggttacaaggtcaacagagtgagaacaaagagaaacaccaaaatg
tatctgaaaacccgtgctcagatgccctacaaagtttttcattaccaggtcaagatccat
ttctttggaaagactaacatgaccaagacaaaccagccattcctgatctctctctatggc
accctagatgagagtgagaacattggtttcacgctgcctgaagtctcctcaaacaagacc
ttctccttcttgatttacacagaagtggatattggagacctgcttatggtgaagctgcag
tgggaaaaagacaccttcttcagctggtcagactggtggactccttttacatttgacatc
cagagaatcagaatgaagtcaggggaaactcagaaaaaagtggtgttctgctctcgagat
ggcacttcgcgtctcagcaagggagaagaggcagcaatatttgtgaaatgctcggagcag
cccgccaacaggaagagaggaggtaccaagaaagcctcgaaagaaaattctgctcatgaa
tctgcttaa

DBGET integrated database retrieval system