KEGG   Taeniopygia guttata (zebra finch): 100223899Help
Entry
100223899         CDS       T01082                                 

Gene name
ARG2
Definition
arginase, type II
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100223899 (ARG2)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100223899 (ARG2)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100223899 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 356 aa AA seqDB search
MALRGSLARLLRAQPDAALRPRRGAHSVALVGALLSRGQKRRGVDHGPATLRAAGLVERL
AGLGCQVHDFGDLNFTQVPNDELYNNLILYPRSVGLASQMLADVVSRAVAAGHRCVTLGG
DHSLALGSISGHTRQCPHLGVIWVDAHADINTPLTTQSGSLHGQPLSFLLRELQNKVPQL
PGFSWLKPCLSASDIVYIGLRDVDPAEYYILKNFDIQYFSMRDIDRLGIQKVMERTFEQL
MGRRQRPIHLSFDIDAFDPSLAPATGTPVLGGLTYREGMYITEEIHNTGMLSAVDMVEVN
PLLGASQEAVKATAHLAVDVIATCFGQTREGAHIAFDELPTPSSPDESDSEEQVRI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggccctgcgcgggtccctcgcccgcctgctccgcgcccagcccgacgccgcgctccgg
ccgcgccgcggggcgcactccgtggcgctggtgggagccctgctctccaggggccagaaa
cggcggggagtggaccacggccccgctaccctccgcgccgcggggctggtggagcggctg
gccgggctcggatgccaagtgcacgactttggagatttgaatttcactcaagttcccaac
gatgaactgtacaacaacctgattttatatccacggtcagtgggcttggccagccagatg
ctggctgatgtagtgagcagagcagtagctgctggacacagatgtgtgactttaggaggt
gatcacagcttggcacttggatccatcagtggccatacaaggcagtgcccacacctcggg
gtgatctgggtggatgcacatgctgatatcaacacacctctcacaactcagtctggaagc
ctccatggacaacctctctcattcctcctaagggaacttcaaaataaagtaccacaactt
cctggcttttcctggctaaagccctgcctttcagcatctgatattgtgtacattggtttg
agggatgtggatcctgctgagtactatattttgaagaactttgacatccagtatttttcc
atgagggatatcgatcgccttggaattcagaaagttatggaaagaacctttgaacaactg
atgggcaggagacagagaccaattcatttgagttttgacattgatgcttttgatccctca
ctggctccagcaacggggactcctgttctaggtggattaacttacagagaaggaatgtac
atcacagaggaaatacacaacacaggaatgctttcagctgtagacatggttgaagtcaat
ccactgctcggagcttctcaagaggcagtgaaagcaactgctcaccttgcagtcgatgtg
atagcaacgtgctttgggcagacaagggaaggagcacacatcgcttttgatgaactccca
acacccagctctccagatgaatctgacagtgaagagcaagtgaggatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system