KEGG   Taeniopygia guttata (zebra finch): 100224059Help
Entry
100224059         CDS       T01082                                 

Gene name
LYPLA1
Definition
lysophospholipase I
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:tgu00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 230 aa AA seqDB search
MCGNNMSAPLPAIVPAARKATAAVIFLHGLGDTGHGWSEALAGIKSPHVKYICPHAPVMP
VSLNMNMSMPSWFDIIGLSPDSQEDEAGIKQAAENVKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTTHQKLAGVIALSCWLPLRASFPQGPISGVNKDIAVLQCHGDCDPLVPVM
FGSLTVEKLKTMINPANVTFKTYSGMMHSSSLEEMMDVKQFIDKHLPPID
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcaacaacatgtcggctcctctgcctgccatcgtcccggccgccaggaaggcg
acggccgccgtcatttttcttcacggattaggagataccgggcacggatggtcagaagca
cttgccggtatcaaaagcccccatgtgaaatacatttgcccacacgcgccagttatgcct
gtttctttgaacatgaacatgtctatgccatcatggtttgatatcattggactttctcca
gattcacaggaagatgaagctggcatcaagcaggcggcggagaatgttaaagcactgata
gatcaagaagtaaaaaatggaattccttctaatagaattattctgggaggcttttctcag
ggaggtgctttatcattgtatacagctcttacaacacatcagaaattagcaggtgtcata
gccctcagctgttggcttcctctacgggcttcttttcctcagggccctatcagtggtgtc
aacaaggatattgctgttcttcagtgccacggggactgtgaccccctggttcctgtaatg
ttcggctccctcactgttgagaagctgaagactatgataaatccagccaatgtaaccttc
aagacctactctggcatgatgcatagttcatctcttgaggagatgatggatgtaaaacag
ttcatagacaaacatctacctcccatagactga

DBGET integrated database retrieval system