KEGG   Taeniopygia guttata (zebra finch): 100224083Help
Entry
100224083         CDS       T01082                                 

Definition
trypsin I-P1-like
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Neuroactive ligand-receptor interaction
Influenza A
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100224083
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100224083
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100224083
Peptidases [BR:tgu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100224083
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100224083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 249 aa AA seqDB search
MKCLLLLAFIGVAVAFPTFAEDDDDKIVGGYTCGKNAVPYQVSLNSGYHFCGGSLISSQW
VVSAAHCYKSRIQVQLGKHNLETTESTQQLINSAKVIRHSGYSPYTLDNDIMLIKLATPA
TLNKAVQTIPLPTSCVATGTTCLISGWGNTLSSGSNYPDQLQCLNAPVLSAAECSDAYPG
QITNNMMCVGFMEGGKDSCQGDSGGPVVCNGELQGIVSWGLGCAQEGYPGVYTKVCNYVS
WIQSTIASH
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcctgctgcttctcgcctttattggggtggctgttgccttccccacctttgct
gaagatgacgatgacaagattgtgggaggctacacctgtggaaagaacgctgtgccctat
caagtgtccctgaattctggatatcacttctgtggaggttccctcatcagcagccagtgg
gtcgtgtcagctgctcactgctacaaatctcgcatccaagtgcagctcgggaaacacaac
ctggaaaccaccgaatccacacagcagttgatcaactctgctaaagtcatccgccactct
ggctacagcccctacaccctggacaatgacatcatgctcatcaagctggccaccccagcc
acgctcaacaaagctgtccaaaccattcctctgcccaccagctgcgtggccaccggcacc
acctgcctgatctccggctggggcaacactctcagcagtggctccaactacccggaccaa
ttgcagtgcctgaatgctccagtcctctccgctgctgagtgctctgatgcctaccctggg
caaattaccaacaacatgatgtgtgtaggattcatggagggaggaaaagactcctgccag
ggagattccggcggtcctgtggtctgcaacggagagctccagggcattgtctcctggggt
ttaggatgtgcccaagagggctaccctggagtttacaccaaggtttgcaactacgtctcc
tggatccagtccaccattgcctcccactga

DBGET integrated database retrieval system