KEGG   Taeniopygia guttata (zebra finch): 100224106Help
Entry
100224106         CDS       T01082                                 

Gene name
USP40
Definition
ubiquitin specific peptidase 40
Orthology
K11869  
ubiquitin carboxyl-terminal hydrolase 40 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 1267 aa AA seqDB search
MGSTAFFIVNAYCIFLKDSSAFTMFGDLFEEDFSFISNNHYGKGKKSKPRESEPPAPRDF
TNLSGIKNQGGTCYLNSLLQTLLFTPEFREALFSLGPEELGTLDDSRKPDAKVRIIPLQL
QRLFAQLLLLDQQAASTTDLTESFGWSGHEEMRQHDVQELNRILFSALETSLVGTSGHDL
INRLYHGIVVNQIVCKECKNVSERQEDFLDLTVAVKGVAGLEEALWNMYVEEEYFENDNL
YRCGACDKLVEASKSAKLRKLPPFLTISLLRFNFDFEKCERYKETSCYTFPIQINLRPFC
EQTEMDDSEYMYELFSVIIHKGGCYGGHYHVYIRDVDELGNWQLQEEEDGLIEEKALRDT
ENAKETENPLAVLKGILSEEEAKQIPVDQLGQKLLEKKGVSWNKKYRKQYGALRKYLQNH
PQIFQLSPDGNKVGLKETHKLLFKLDSHGQNLQSPSQKNDVQWNCEKNPPRPRAASAGCH
WFDLNDSKVQPIKEKDIEKQFQGKESAYMLFYRKAQLKRPPEARGNPRYQIPEHLLNEMN
AANTELRKKRAECDSANNGIDLHLHLSSCYKFHNGALHPSLSCKESVVDLTIDRRKTLGD
LRQAVLQVLESWEGDVVLSMAKPLPAGLHLYQVLDGDELILDGIGLADGADIFVWNGKEV
GGTKVLTGPEHEPVVLNVLRLAEHNEGGKGQHFSEAQHVFPCSTSLGQLHSALAPAGGII
LRNGSGVDTEAKNWQVFHEEDMKETVRSVGLRDGCSVLILDSHDQSFVNLASGNLTAFTY
DISWLQVKNFCGVEEEAKHVKITATIETVMSDIKMKAIREFQLQEELGNENCLRPVSGNG
KLLSPVSEDYTVKEAELKMGSLLGLCRGKAPTSTQLFLYFMVGSDQSCSPEMEIVVEETA
SVGECLNLMLEKSGLSGDNWHLRRLDWCYEAGEALSQENATLKELNVCRGDTLIITEGKL
PEKGFLKIPIWWLKPSSHKKHGENAQDQVNGMTWKMEALQVSAAAAPAEPTHPGLDLCYA
GRIEIAGEASLEDLKMQVLTLPCCQEQVVPLPSFLRAWTVDSKRPGKLLRDNKRTLSDYR
LGARVEICIEPLQEEENLGPHELLLRVQMGIPGERDYTSSRDLVWDISKECTAWALRQRV
ASHYCLPVDKIEIAKYFPERFEWLPLSSWTQQISKRKRRKKQASLQSAPYHLKDGDIIGV
KNLLLDDTKDFSTVRDDIGKEKQRQLALEKRKSRQERVQDPLFPDEKLPPKPRKPEVALS
INVGVFR
NT seq 3804 nt NT seq  +upstreamnt  +downstreamnt
atgggttcaactgcattttttatagtaaatgcttattgtatctttttaaaagactcttct
gccttcacaatgtttggggacttatttgaagaggatttttcctttatttccaacaatcat
tatgggaaagggaagaaatcaaagcccagagagtctgagcctccagctcccagggatttc
accaacctcagtggaatcaaaaatcagggtgggacctgctacctcaattcccttctgcag
actctgcttttcacgcctgaatttagagaggctttgttctccctgggacctgaagaactt
ggtactctggatgacagcaggaagccagatgcaaaggttcggatcatcccactgcagctg
cagcgcttgtttgctcagctcctgctcctggaccagcaggctgcatccaccacagacctc
accgagagcttcggctggagcggccacgaggagatgaggcagcacgatgtgcaggaattg
aacaggatcctcttcagtgctctggagacttccctggtggggacatcaggccatgacctc
atcaaccgcctgtaccatggcattgttgtcaaccagatcgtctgtaaggagtgcaagaac
gtcagtgagagacaggaagatttcttagacctcacagtggcagtgaaaggtgtggctggc
ttggaggaggccctgtggaacatgtacgtggaggaagaatactttgagaatgacaacttg
tatcgatgtggagcctgcgataaactggttgaagcttcaaagtctgctaaactacgcaag
ctgcctcccttcctcaccatttccctcctgaggttcaactttgactttgagaagtgtgag
aggtacaaggaaacgagctgctacacattccccatccagatcaacctgaggcctttctgt
gagcagactgaaatggatgattcagagtacatgtatgagctcttctctgttattatacac
aaaggtggctgctatggaggacactatcatgtttatatcagagatgtggatgaattagga
aactggcaactccaagaagaagaggatggactgattgaagagaaggctttaagagacact
gagaatgccaaagaaacagaaaatccactggcagtcttaaaagggattttgtcagaggaa
gaagctaaacaaattcccgtggatcaattagggcagaaattactggagaagaaaggggtg
tcctggaataagaaatacagaaaacaatatggagcattacgaaagtatttgcagaatcat
cctcagatattccagctgagtcctgatggaaataaggtcggcctgaaggaaacacacaag
ctcctcttcaagctggattctcatggacaaaatctccagagcccttcccagaagaatgat
gtccagtggaactgtgagaaaaaccccccaaggccaagggctgcttctgctgggtgccac
tggtttgatctgaatgattccaaagtacagcccatcaaggagaaggatattgagaagcag
ttccagggtaaagagagtgcctacatgctgttctacagaaaagctcagctgaagaggccc
cctgaagcacgtggaaatccaaggtaccaaattcctgagcacctgctgaatgaaatgaat
gctgctaatacagagctgcgaaaaaagagagctgaatgtgactcggcaaacaatggcatt
gatttacatctccacctgagctcctgctataaattccacaatggggctttgcatccttca
ctttcttgcaaagagagtgtagtggatttgactattgacagaaggaagacactgggagac
cttcggcaggcagtgttacaggtgttggagtcttgggaaggggacgtggttctcagcatg
gccaagcctttgccagcaggattacacctgtaccaggtgcttgatggagatgagctgatc
ctggatggcattgggctggctgatggagcagacatctttgtctggaatggaaaagaggtt
ggaggcaccaaggtgctcacgggccctgagcacgagcccgtggtgctcaacgtgcttcgc
ttggccgagcacaacgagggcggcaaggggcagcacttcagcgaggcgcagcacgtgttc
ccctgcagcaccagcctggggcagctgcactctgccctggctccggccgggggcatcatc
ctcaggaacggctcaggagtagacactgaagccaagaactggcaagttttccatgaggag
gacatgaaggaaacagtccgaagtgttgggctcagggacgggtgctctgtgctgatctta
gacagccatgaccagagctttgtcaacttagcaagtggaaatttgactgctttcacctat
gacatcagctggctccaagtgaaaaacttctgtggggtggaagaggaggcgaaacatgtt
aaaatcactgccactattgaaacagtgatgtcagatatcaaaatgaaagcaatccgggag
ttccagctgcaggaggagctgggaaacgagaactgtcttagacctgttagtggtaatggg
aaacttctgtctccagtgtctgaggattacacagtcaaggaagcagaacttaagatggga
agcttgcttggcctgtgccgtgggaaagctccaacttccactcagctcttcctgtacttc
atggttgggagtgaccaaagctgcagccctgagatggagatagttgtggaggagactgcc
tctgtcggagagtgtctcaatttaatgctggagaaatcaggattatcaggtgacaactgg
catttgagaaggcttgactggtgctacgaggcaggggaagcattaagtcaggaaaatgcc
accctgaaggaactcaatgtttgcagaggagacactttgattataactgaaggaaagctt
ccagaaaagggtttcctgaaaatccccatctggtggctgaagccttcaagccataagaaa
catggagagaatgcacaagaccaggtgaatgggatgacctggaagatggaggctttgcag
gtgtctgctgcagcagctccagcagaacctacccacccaggcctggatctctgttatgct
ggcaggatagagatagcaggagaggcctcgctggaagatctgaagatgcaggttctgacc
ttaccctgctgccaggagcaggttgtgcccctgccctcattcctcagagcttggacagtg
gacagcaaacgccccgggaagctcctacgggacaacaaaaggacactcagtgactacagg
ctgggtgccagagtggaaatctgcatagaacccttgcaagaagaagagaatttgggcccc
cacgagctgctgctgcgagtccagatgggaataccaggagagagggactacaccagctcc
cgggatttggtgtgggatatctccaaggaatgcacagcctgggctctgaggcagagagtg
gcttctcactattgtctccctgtagataaaattgaaatagccaaatacttccctgagaga
tttgagtggctgccattatctagctggacacagcaaatctcaaagaggaaaaggaggaaa
aagcaggcaagtttgcagtcagcaccttaccacctgaaggatggagacatcattggggtg
aagaaccttctccttgatgacaccaaggacttcagcactgtcagggacgacattgggaaa
gagaagcaaaggcagctggctctggaaaagaggaaaagccgccaggaacgtgtccaggat
ccccttttccccgacgagaagctccccccaaagccccgcaaaccagaagtggctctttcc
atcaatgtgggggttttcagatag

DBGET integrated database retrieval system