KEGG   Taeniopygia guttata (zebra finch): 100224179Help
Entry
100224179         CDS       T01082                                 

Gene name
XRCC4
Definition
(RefSeq) X-ray repair cross complementing 4
  KO
K10886  
DNA-repair protein XRCC4
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    100224179 (XRCC4)
DNA repair and recombination proteins [BR:tgu03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     100224179 (XRCC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Z
AA seq 334 aa AA seqDB search
MEKTLNRIHPVSDPEATYFLQVSWEKDLGTGFGLLLSDCQCVWTGTVSESDISTEAADIE
MDREKYVGELRKALIAGEESAGKYNFVISRDEQNKVCHFSYERNLKDGSFRLGSLKLQEV
PNPAEVMKELIGYCLDSLGKLQAKTEDLQRENERLFSNWSDVEKRLEKCVEAKEDLEADL
YSRFVLVLNEKKAKIRNLQKLLSEAKESAVDAKCSRDSIATTQMVVKKENNYDASTDEES
ENPARASLPSALERRDSSLLGSPDIVDPAPRRKRRQRTAKPAGTGAKVANYEAEQPAQEK
PGLSSQGTSGQRCPDWDLETLENSCEPEDLFEDM
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggagaagactttgaacagaattcatccagtttctgatccagaagcaacctattttcta
caggtgtcatgggaaaaggatttaggcactggctttggtttacttcttagtgattgtcag
tgtgtctggactgggacagtgtctgaatcagacatttctacagaggctgctgacatagaa
atggacagagagaaatatgtgggagagctgaggaaagcactgatagctggagaagagtca
gctggcaaatacaactttgtgatctcaagagatgagcagaataaggtctgtcacttctcc
tatgaaaggaacctgaaagacggctctttcagactcggatctctgaagctgcaggaagtc
ccaaacccagcagaggtgatgaaggaactcattggttactgcctggacagcctgggaaag
ctgcaggccaaaactgaggatctgcagagggaaaatgagaggcttttcagcaactggagt
gacgtggagaagaggctggaaaaatgcgtggaagctaaagaggatctggaggcagacctt
tacagcaggtttgttttggtgctgaacgaaaagaaggcaaagataagaaacttgcagaag
ttgttgagtgaagctaaagaatctgcagtggatgccaaatgctcaagggatagtatagct
actactcagatggttgtaaagaaagaaaacaactatgatgccagcactgatgaagaaagt
gaaaatccagcacgggcctcgctgccatcagctctggaacgaagggactcctccctgctg
ggcagcccagacatcgtggacccagctcccaggagaaaacgaagacaaaggacagcaaaa
cctgcaggcacaggagctaaagtggctaattacgaggcagagcagccagcccaggaaaag
cctggcctgtcctcacaggggacatcggggcagcgttgcccggattgggatctggaaacc
ctggaaaactcctgtgagccagaggacctcttcgaggacatgtag

DBGET integrated database retrieval system