KEGG   Taeniopygia guttata (zebra finch): 100224188Help
Entry
100224188         CDS       T01082                                 

Gene name
PIK3CD
Definition
phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit delta
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Influenza A
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100224188 (PIK3CD)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100224188 (PIK3CD)
   04370 VEGF signaling pathway
    100224188 (PIK3CD)
   04630 Jak-STAT signaling pathway
    100224188 (PIK3CD)
   04068 FoxO signaling pathway
    100224188 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    100224188 (PIK3CD)
   04150 mTOR signaling pathway
    100224188 (PIK3CD)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100224188 (PIK3CD)
  Cell growth and death
   04210 Apoptosis
    100224188 (PIK3CD)
  Cellular commiunity
   04510 Focal adhesion
    100224188 (PIK3CD)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100224188 (PIK3CD)
  Endocrine system
   04910 Insulin signaling pathway
    100224188 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    100224188 (PIK3CD)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100224188 (PIK3CD)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100224188 (PIK3CD)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100224188 (PIK3CD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 1098 aa AA seqDB search
MGRAAFVCPQGTIAPAGVVPLKGLHEFDSVQDPEVSDFRTKMCQFCEEKAAKRQQLSWAA
WMEYNFPLQLEPVAKGLGVGSLQIPTKNIFVNIKFQSGGESFTFQISPWEFPITLMSYAI
KKQATVFRHETVQKPEDYTLQVNGKCEYLYGNYPLYQFQHIRSCLQRGRTPHLTMVHSSA
IIAMRDEQTNGITSPPKAAPKPPPLPKKKPNYGSLWSLEQPFYIELVQGSKVNADERMKL
VVQAGLFHGTEMLCKTVSSSEVSVCSEPVWRQRLDFDISVCDLPRMARLCLALYAVVEKA
KKARSTKKKSKKADCPIAWVNVMLFDYKDQLKTGECCLHMWSSFPDEKGELLNPMGTVQC
NPNTESAAALVICFPSVAAHPVYYPSFAQLLELGRNGEQPRAAPEDSEEKLQLREILERR
SHTELYEHEKDLVWKMRYDIRDQYPQALAKLLVITKWNKHEDVAQMISLLQTWPELPVLN
ALELLDFSFPDRYVGSFAVNSLKKLTDDDVFQYLLQLVQVLKYESYLDCELTKFLLERAL
SNRKIGHFLFWHLRSEMHVPAVALRFGLILEAYCRGSTHHMKVLMKQGEALNKMKALNDF
VKVSSQKATKPQTKEMMHMCMKQETYREALSHLQNPLNPNIILAEVCVDQCTFMDSKMKP
LWIVFNNEETGGGGVGIIFKNGDDLRQDMLTLQMIQLMDILWKQEGLDLRMTPYGCLSTG
DKTGLIEVVMHSDTIANIQLRRPGQAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRETG
QLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNNEKFERFRGYCERAYM
ILRRHGLLFLHLFALMKAAGLPELSCSKDIQYLKDSLALGKTDEEALKHFRVKFNEALRE
SWKTKVNWLAHNVSKDNRQDALDQAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRETGQ
LFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNNEKFERFRGYCERAYMI
LRRHGLLFLHLFALMKAAGLPELSCSKDIQYLKDSLALGKTDEEALKHFRVKFNEALRES
WKTKVNWLAHNVSKDNRQ
NT seq 3297 nt NT seq  +upstreamnt  +downstreamnt
atgggcagagctgcttttgtgtgccctcaagggacgatcgctcctgccggggttgttcct
ctcaaaggtttgcacgagtttgactctgtgcaggacccggaggtgagcgatttccgcacc
aagatgtgccagttctgcgaggagaaagcagcgaagcggcagcagctcagctgggcagcg
tggatggagtacaacttccccctgcagctggagcccgtggccaagggcctcggtgttggc
tctctgcaaatccccaccaagaatatttttgtcaacatcaagttccagtctggcggggag
agcttcaccttccagatctccccctgggagttccccatcaccttaatgagctatgccatt
aagaaacaggccactgtgttccgccacgagaccgtgcagaagccagaggactacaccctg
caggtgaatgggaaatgtgaatatctctatgggaactaccccctgtaccagttccagcac
atccgcagctgcctgcagcggggccggaccccgcacctgaccatggtgcactcctctgcc
atcattgccatgagggacgagcagaccaacggcatcaccagccccccaaaggcggccccc
aagccccccccgctccctaagaagaagccaaactacggctctctctggtccttagagcag
cctttctacatcgagctggtgcaaggcagcaaggtcaatgcagatgagaggatgaagctg
gtggtgcaggcagggctgttccacggcactgagatgctgtgcaagaccgtgtcgagctcg
gaggtgagcgtgtgctcggagccggtgtggaggcagcgcctggacttcgacatcagcgtc
tgcgacctgccccgcatggcgcggctctgcctcgccctctacgccgtcgtcgagaaggcc
aagaaggctcgttccaccaagaagaagtccaagaaagctgactgtcccatcgcctgggtc
aacgtgatgctcttcgactacaaggaccagctgaaaacaggggagtgctgcctgcacatg
tggtcctccttcccagatgagaaaggggaacttctgaaccccatgggcacagtgcagtgc
aaccccaacacggagagtgcagcagccttggtcatctgcttccccagcgtggcagcacat
cctgtgtactacccatcctttgcgcagctgctggagttgggaaggaatggagagcagccc
cgagcggcaccagaggattctgaggagaagctgcagctgagggagatcctggagcggagg
agccacacggagctgtacgagcacgagaaggacctggtgtggaagatgcggtacgacatc
cgcgaccagtacccgcaggccctggccaagctgctcgtcatcaccaagtggaacaagcac
gaggatgttgcccagatgatttccctgcttcagacctggccagagctgcctgtcctgaat
gccttggagctgctggatttcagctttcctgaccgttacgttggttcctttgctgtcaac
tccctgaagaagctgacggatgatgatgtgttccaatacctgctgcagcttgtccaggtg
ctcaagtatgaatcctacctagactgtgaattaaccaagttcctgctggaaagggcatta
tccaaccgcaagatcggccacttcctcttctggcatctgaggtcggagatgcacgtgccc
gccgtggccctgaggtttgggctgatcctggaagcgtactgccggggcagcacccaccac
atgaaggtgctgatgaagcagggagaagcactgaacaagatgaaagctctgaatgacttt
gtgaaagtgagttctcagaaggccaccaagcctcaaaccaaggagatgatgcatatgtgc
atgaagcaggaaacctacagggaagccctttcccacctccagaaccccctgaaccccaac
attatcctcgctgaagtttgtgtggatcagtgcacctttatggactccaaaatgaaacct
ttgtggattgtgtttaataatgaagagacaggtggaggaggagtgggtataatttttaaa
aatggagatgatctgcgccaggacatgctgaccctgcagatgatccagctgatggacatc
ctgtggaagcaggagggcctggacctgaggatgaccccttatggctgcctctccacagga
gacaagacggggctgattgaggtggtcatgcactcggacaccatcgccaacatccagctc
agacgcccaggccaagccatcgaggagttcaccctttcctgtgctgggtactgcgtggcc
acatacgtgctgggcattggggaccggcacagcgacaacatcatggtccgggagacgggg
cagctgttccatattgattttggtcactttttggggaacttcaagactaaatttggtatt
aatagagaacgagtccctttcatcttaacctatgactttgtgcatgtcatccagcaagga
aaaactaacaacaacgagaagtttgaaaggttcaggggttactgtgaaagggcctacatg
atcctgcggcgccacgggctcctcttcctgcacctctttgcactgatgaaggctgctggg
ctgcctgagctcagctgctccaaagacatccagtacctaaaggactccctggcccttggg
aaaaccgatgaggaggcactgaagcacttcagagtgaagttcaatgaagccctgcgggag
agctggaaaaccaaagtgaactggctggcacacaacgtatccaaagacaacaggcaagat
gccttggaccaagccatcgaggagttcaccctgtcctgtgctgggtactgcgtggccacc
tacgtgctgggcattggggaccggcacagcgacaacatcatggtccgggagacggggcag
ctgttccatattgattttggtcactttttggggaacttcaagactaaatttggtattaat
agagaacgagtccctttcatcttaacctatgactttgtccatgtcatccagcaaggaaaa
actaacaacaatgagaagtttgaaaggttcaggggttactgtgaaagggcctacatgatc
ctgcggcgccacgggctcctcttcctgcacctctttgcactgatgaaggctgctgggctg
ccagagctcagctgctccaaagacatccagtacctaaaggactccctggcccttgggaaa
actgatgaggaggcactgaagcacttcagagtgaagttcaatgaagccctgcgggagagc
tggaaaaccaaagtgaactggctggcacacaacgtatccaaagacaacaggcagtag

DBGET integrated database retrieval system