KEGG   Taeniopygia guttata (zebra finch): 100224196Help
Entry
100224196         CDS       T01082                                 

Definition
(RefSeq) histone H2B 5-like
  KO
K11252  
histone H2B
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100224196
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1A
AA seq 182 aa AA seqDB search
MLTQGHGVFVSDSELASNSDFLILQYNYSVEGQKLIRFFFLYSLQAAPRQSERVLRMPEP
AKSTSAPKKGSKKAVTKTQKKGDKKRHKSRKESYSIYVYKVLKQVHPDTGISSKAMGIMN
SFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS
SK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgctcacacagggccatggggtgtttgtctcagattctgagcttgcctccaactcagac
tttctcatcttgcagtacaattattctgtagaaggtcaaaaactaattagattttttttt
ttatattctctccaagcagctccaagacagagcgaaagagttctcaggatgccagagcca
gcaaagtcaacctcagctcccaaaaagggctccaagaaagcggtgacaaagacccagaag
aagggcgataaaaagcgtcacaaaagcaggaaggagagctactccatctatgtctacaag
gtgctgaagcaggtccatcctgacactggcatctcctccaaggccatgggcatcatgaac
tccttcgtcaatgacatctttgagcgcattgctggagaagcctcccgcctggcccattac
aacaagcgctccaccatcacgtcccgggagattcagacggccgtgcgcctgctgctccca
ggagagctggccaagcacgcggtctcagagggcaccaaggctgtcaccaagtacacgagc
tccaaatag

DBGET integrated database retrieval system