KEGG   Taeniopygia guttata (zebra finch): 100224220Help
Entry
100224220         CDS       T01082                                 

Definition
cytochrome P450 2J2-like
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100224220
   00591 Linoleic acid metabolism
    100224220
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100224220
Cytochrome P450 [BR:tgu00199]
 Cytochrome P450, animal type
  CYP2 family
   100224220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 492 aa AA seqDB search
MLNFLRDSISLQTFLIFLFIFLLIADYMKNRNPNNFPPTPFRLPFLGHVYLLDFKDPAVT
ARKLSKRYGDIFGIHMGSMKFVMVNGMRLVKEVLVNQGDKFLDRPDIPIDEEIFSKIGLI
SSIGHLWKAQRRFTLSTLRNFGLGKRSLEERIQEECRYLVDVFGDEQGNPFNPQMKVTNA
VANVICSLIFGNRFEYHDEDFQRLLKLMYEMTVLHGAVTSQLYNSFPSIMKYLPGAHHTI
FKNWRLLKKFMQEQINKHKEDWNPSESRDYIDSYLLEISKDHDSDTFQEEHLIACSLDLM
FAGTETTSSTLRWALLFMATHPEIQARVQAEIDTFIGQARPPALEDRNNLHYTNAVIHEV
QRKGNVIPFNVPRMASEDTYVDGYYIPKGTGIMANLSSLLLDENEWKTPNTFNPEHFLKD
GKFWKNDHFLPFSLGKRACLGELLARSELFLFFTCLLQKFTFQAPPDTTLTLQPLIGITV
APQPYKICAVPR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacttcctccgggacagcatctcccttcagacattcctcatctttctcttcatc
ttcctgctcatcgcagactacatgaagaacagaaatccaaataatttccctcccaccccc
ttccgccttccctttttggggcacgtctacctcttagacttcaaagatcctgcggtcaca
gcgaggaagctaagtaaaagatatggtgacatctttggcatccacatgggcagcatgaag
tttgtgatggtaaatgggatgcggctggtgaaggaagtgctcgtaaaccaaggggacaag
ttcttggaccgccctgacattcccatcgacgaggagatcttcagcaagatcggactgatc
tcctccatcgggcacctgtggaaggcacagaggcggttcaccctgtccacgctccgaaac
tttggcctggggaagaggagcctggaggagcgcatccaagaggagtgccgatacctcgtg
gatgtgtttggggatgaacaggggaatcctttcaaccctcagatgaaagtcaccaatgct
gttgcaaatgtcatctgctccctcatctttggcaatcggtttgaataccacgatgaggat
ttccaaaggctgctgaagctgatgtatgaaatgactgtcctccatggagctgtcacaagc
cagctgtacaacagtttcccatctataatgaagtacttacctggagcccaccataccatt
tttaaaaactggaggttattgaaaaaatttatgcaagagcagatcaacaaacacaaggag
gactggaacccctcagagagccgggactacatcgacagctacctgctggagatctccaag
gaccatgacagtgacaccttccaggaggaacacctcatagcctgctcactcgacctgatg
tttgctgggactgagaccacatcctccactctccgctgggctttgctgttcatggccacg
cacccagaaattcaagcccgggtgcaagcagagattgacacgttcatcggccaggcacgg
cccccagccctggaggacaggaacaacctgcactacaccaacgctgtcatccacgaagtg
cagaggaaaggcaatgttatccctttcaatgtgccaagaatggcatcggaggacacctac
gtggatggctactacatcccaaagggcactggtataatggcaaatttatcctctctgctg
cttgacgagaatgagtggaaaacccctaatacttttaaccccgagcattttctgaaggat
gggaagttctggaaaaatgaccatttcctaccattttctttggggaagcgtgcctgcctg
ggtgagctgctggcccgttctgagctcttcctcttcttcacctgcctgctgcagaaattc
acctttcaggcacccccggacaccacactcaccctccagcccttgataggcatcacagtg
gccccacagccctacaagatctgtgcagtacctcggtag

DBGET integrated database retrieval system