KEGG   Taeniopygia guttata (zebra finch): 100224334Help
Entry
100224334         CDS       T01082                                 

Gene name
UNC13B
Definition
(RefSeq) unc-13 homolog B (C. elegans)
  KO
K15293  
protein unc-13
Organism
tgu  Taeniopygia guttata (zebra finch)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Z
AA seq 1571 aa AA seqDB search
MARQQSAVNQSSSAFNQMNIKQGVPPLGEISRLDLGLIVEVWNKGLIWDTLVGTVWIALK
AIHQSDEEGPGEWSTLEAEVVMKHDEICGTKNPTPHKILLDTRFELPFDIPEEEARYWTR
KLEQINSLGDDEYPFQEEVQKKPLPSAASQCSFEDADSAVDDRDSDYRSETSNSIPPPYH
TTVQPNASVHQFTGPARLQQQGVLRDSCANSLQNYDLDYQEHVAASPAGSSRYSSSCNVS
QESSHLSELEHSHESAHGSEQEDDHQERQSNHSYHSSSSYQKDGQAWLKEQEEPHGKGEE
EKVCKTEEKLADHSATKLSLELEKPKDVDTGVQMSYQADIEPPPFPPARARWIRAISKVR
LQLQQGQDEADPSKPPWLKGGPAGALYGIDSMPDLRKKKPIPLVSDLSLVQSRKAGITSA
MATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQ
GMRCGECGVKCHEKCQDLLNADCLQRAAEKSSKHGTEDRTQNFIMAMKDRMKIRERNKPE
IFDLIRDVFCESKMTHAQQMKTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPY
VTVQVGKTKKRTKTIFGNLNPVWEEKFYFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRE
SDDFLGQTIIGVRTLSGEADGFCLLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYT
CLHENLFHHLTDVQGNGVVKIPDAKGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTH
FACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQL
HNSLRIDLSMYRNNFPASSRERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCV
KACLNSTYEYIFNNCHELYSREYQTDPNKTQDLPAEEQGPSIRNLDFWPKLITLIVSIIE
EDKNSYTPVLNQFPQELAVGKISAEVMWSLFAQDMKYAMEEHEKHRLCKSADYMNLHFKV
KWLYNEYVCDLPAFKGKVPEYPAWFEQFVMQWLDENEDVSLDFLHGALERDKKDGFQQTS
EHALFSCSVVDVFTQLNQSFEIIKKLECPDPVIVAHYNRRFAKTIGKVLMQYADILSKSF
ESYCSKEKLPCILMNNIQQLRVQLEKMFEAMGGKELDAEASDHLKELQVKLNNVLDELSA
VFGNSFQTRIDECVKQMSDILCQVKGTANSAANARNTVAQDADNVLRPLMDFLDGNLTLF
ATVCEKTVLKRVLKELWRVVMNTMEKLIVLPPLTDHTGTQLIFSAAKELGHLSKLKDHMV
REETRSLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDT
LIKTFVQSQTAQGSGVDDPVGEVSIQIDLYTHPGTGEHKVTVKVVAANELKWQTSGMFRP
FVEITMIGPHQSDKKRKFTTKSKSNNWAPKYNETFHFILGNEDGPDAYELQVCVKDYCFA
REDRVLGIAVMQLRDIADKGSCACWCPLGRRIHMDETGLTILRILSQRTNDEVAKEFVKL
KSESRSTEEGT
NT seq 4716 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggcagcagtcagcagtcaaccagtcatcatcagccttcaatcagatgaatatc
aagcagggagtacctccactcggtgagatcagtcggctggacctgggcctaattgtggaa
gtatggaacaaaggactgatatgggacactctggttgggaccgtgtggattgctctgaag
gccattcaccaatctgatgaggaaggtcctggggaatggtctacactggaggcagaagtt
gtaatgaaacatgatgaaatctgcggaaccaaaaacccaactcctcataaaattttgctg
gacacaaggtttgaattaccttttgatatccccgaagaagaggccagatactggaccaga
aaattagaacaaattaattcactgggagatgatgagtatccctttcaggaggaagtccag
aagaaaccattgcccagtgctgcctcccagtgttcctttgaagatgctgatagtgccgtg
gatgaccgggacagcgactaccgcagcgagacgagcaacagcattccccctccataccac
accaccgtgcagcccaacgcctctgtgcaccagttcacgggcccggctcgcctgcagcag
cagggagtcctgcgggattcctgtgccaactccctccagaactatgatcttgattatcag
gagcatgtggctgccagtcctgctggcagtagtagatacagctcctcttgcaatgtcagc
caggaaagctctcacctcagtgagctggaacattcccatgaaagtgcccatggctctgag
caggaggatgatcaccaggaaaggcagtcaaatcactcttaccatagttcgagcagctac
cagaaggacggtcaggcatggctcaaagagcaagaggagcctcatggcaaaggagaggag
gagaaggtctgcaaaactgaggaaaaacttgcagaccattctgcaactaagttatctctg
gaacttgagaagcccaaggatgttgatacaggagtccaaatgagctaccaggctgacatc
gagccaccaccgtttcctccagcaagagcccgttggattagagccattagcaaagtccga
ctgcagcttcaacagggccaagatgaggctgatccatcaaaaccaccctggctcaaagga
gggcctgcgggtgctctctatggcatcgatagcatgcctgatctgcgcaaaaaaaagcca
attccgcttgtcagtgatctgtcactggttcagtctcgaaaagccggaattacctcagca
atggctactagaacatctctcaaagatgaagagctgaaatctcatgtctataagaagacc
ttgcaagccttaatttaccccatctcatgtacaaccccacacaacttcgaggtgtggaca
gccacaactcccacctactgctacgagtgtgaggggctgctgtggggcatcgcgcggcag
ggaatgcgctgcggggagtgcggggtcaagtgccacgagaagtgccaagacctgctcaat
gctgactgcctgcagagagcagcagagaagagctcaaagcatggaactgaagaccggacc
cagaatttcatcatggccatgaaggatcgcatgaaaatccgggagcggaacaagcctgag
atctttgacttgatcagagatgtgttttgtgagagcaaaatgacacatgctcagcagatg
aagacagtgaaacagagtgtacttgatggtacctcaaaatggtcagcaaagatcacaatc
accgtggtgtgtgctcagggtctgcaggccaaagacaagactggatccagtgatccatat
gtaactgttcaagtgggtaaaacaaagaagaggacaaaaacaatctttgggaatctgaac
cctgtatgggaagagaagttttactttgagtgccataattcctctgaccggatcaaggtg
cgagtgtgggatgaagatgatgacatcaagtctcgtgtcaagcagaggctgaaacgcgaa
tcagatgattttctggggcaaacaatcattggagttcgcactctgagcggagaagctgat
ggtttttgccttctagagaagcgaacagataaatctgcagtgtctggggctattcgcctg
caaatcagtgtggagatcaaaggcgaggagaaagtagctccatatcatgttcagtacact
tgccttcatgagaatctctttcaccatctcacagatgtgcaagggaatggggtggtgaag
atccctgatgccaaaggagatgatgcatggaaggtgtattttgatgagacagcccaagag
atcgtggatgagtttgcaatgcgttatggcattgagtcaatataccaggccatgacgcat
tttgcatgtctctcctctaaatacatgtgcccaggcgtaccagctgtgatgagcacctta
cttgccaatatcaatgcttactatgcacacaccactgcctccacaaatgtgtctgcttcg
gaccgctttgcagcctccaattttgggaaagaacgatttgtaaagcttctggatcagctt
cataattcacttcggattgatctctcaatgtacaggaataacttcccagctagcagtcgt
gagcggctgcaggacctgaagtctacagtggatttgctgaccagcatcacttttttcagg
atgaaggtccaagagctgcagagtccaccccgagctagccaggtggtgaaggactgtgta
aaagcttgcctcaactccacctatgagtacattttcaacaactgtcatgagctgtacagt
cgggagtaccagacagatcctaacaaaactcaggaccttcctgccgaggaacagggcccc
agcatcagaaatcttgatttctggcccaagctcatcactttgatagtttccatcatagaa
gaggacaagaattcttataccccagtcctgaatcagtttcctcaggagcttgcagttggg
aagatcagcgcagaggtgatgtggagtctttttgcccaggatatgaaatatgccatggaa
gagcatgagaaacacagactgtgtaaaagtgcggactatatgaatttacacttcaaagtg
aagtggctgtacaacgaatatgtttgtgatctgcctgccttcaagggaaaagtgcctgaa
tatccagcgtggtttgagcaatttgtgatgcagtggctagatgaaaatgaagatgtttcc
ttagacttcctgcatggtgctctggagagagataaaaaagatgggttccagcaaacatca
gagcatgctctgttctcttgctcagtggtggatgtgttcacccagctcaaccagagcttt
gagatcattaagaagctggagtgcccagaccctgtcattgttgcccactacaatagaagg
tttgcaaagactattgggaaagtgctgatgcagtatgctgacatactctccaagagcttt
gagtcctactgttccaaggagaaactgccctgtatcctgatgaacaacatccaacaactg
cgggtgcagctggaaaagatgtttgaagccatgggtggtaaagagttggatgcagaagca
agtgaccatctcaaagagctccaggtgaagctgaacaatgttttggatgagctcagtgca
gtgttcggtaacagctttcagactcggattgatgagtgtgtcaagcaaatgtctgatatc
ctctgtcaagtgaaagggacagcaaattctgctgctaatgccagaaacacagttgcacaa
gatgcagataatgtcctgaggccactgatggacttcctggatggaaacctgacactgttt
gcaactgtgtgtgaaaagacagtgttgaaacgggtgctgaaagagctctggagggtggta
atgaacaccatggagaagctgattgtgctgcctcctcttacagaccatacgggcacacag
ttgattttcagtgctgctaaggaactgggacacttgtcaaagttgaaggatcatatggtg
agagaagaaaccaggagcctcaccccaaagcagtgtgctgttctggacctggcgctggat
acaatcaaacaatatttccatgctggtgggaatggtctgaagaaaaccttcttggagaag
agtccagacctacagtcacttcgatatgctctctccctctacactcagaccacggacact
ctcatcaaaacatttgtccagtcccagacagctcagggctccggtgtggatgatcccgtg
ggagaagtgtccatccagatcgacctgtacacccacccgggaactggagagcacaaggtc
acagtgaaagttgtggcagccaatgaactgaagtggcagacatctggcatgttccgtcca
tttgttgaaatcaccatgattgggccccaccagagtgacaagaagaggaagttcacaacc
aagtcaaagagcaacaactgggctccaaaatacaatgaaacatttcatttcatcctgggg
aatgaagatggccctgatgcctatgagctccaagtctgtgtgaaggattactgctttgcc
cgggaggaccgggttctggggatagcagtgatgcagctcagagacatagcagacaaagga
agctgtgcttgctggtgccccctcgggcgcaggattcacatggatgagactggactcaca
atcctgaggattctctcacagagaaccaatgatgaagttgccaaggaatttgtgaagctg
aaatctgagtcccgctccacagaggaaggcacctga

DBGET integrated database retrieval system