KEGG   Taeniopygia guttata (zebra finch): 100224356Help
Entry
100224356         CDS       T01082                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100224356 (DBH)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     100224356 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 619 aa AA seqDB search
MQSSRSKPCSCPSLKLREVASMYFTMVAAFLVILVVALQGSAPRQSDFPYKVPLDPQGLL
ELSWNVSYPEQAVHFQLLIRELHFGLLFGMSDRGEFENADLAVLWSDGHNSYFGDAWSDA
KGQLHMDSQQDYQLLGARRAPEGLYLLFRRAFSTCDPKDYLIEDGTVHLIYGILEKPVRS
LQAINISALHGGLQRVQLLKPNISIPQLPRDMKTMEITAPDVVIPSQETTYWCYMAELPE
GFPKHHIIMYEPVVTAGNEALVHHMEVFQCAAHFDSFPLYNGPCDSKMKPERLNYCRHVL
AAWAMGAQAFYYPEEAGLAFGGPGSSRYLRLEIHYHNPLVFTGRRDSSGIRLYYTATLRP
YDAGIMELGLVYTPVMAIPPGEDSFILTGYCTDKCTQLALPAAGIRIFASQLHTHLAGRK
VVTVLSRDGRERQVVNADGHYSPHFQEIRMLKEVVAVFPGDELITTCTYNTEDRSRATVG
GFGILEEMCVNYVHYYPQTQLELCKSAVDPGYLHRYFNLVNRFNDEEICMCPQVSVPQQF
YSIPWNTFNRDVLKSLYGFAPISMHCNKSSAVRFPGEWEKQPLPSITERLQEPRPHCSPA
PEPQPAAPVPLQLGQLHSD
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgcagagctccaggagcaagccctgctcctgccccagcctcaagctgcgggaggtggca
tccatgtacttcaccatggtggcagcgttcctggtcatcctggtggtggccctgcagggc
tcggcgccccgccagagcgatttcccctacaaggtgcccctggatccccaggggctgctg
gagctctcctggaatgtcagctaccccgagcaagccgtgcatttccagctgctcatccgg
gagctgcacttcgggctcctcttcgggatgtcggacaggggggagtttgagaacgcggac
ctggccgtgctctggagcgacgggcacaactcctactttggggatgcctggagcgacgcc
aaggggcagctccacatggattcccagcaggactaccagctcctcggggctcgcagggct
cctgaggggctctacctcctcttcagaagagccttcagcacctgtgaccccaaggactac
ctgatagaggatggcaccgtgcacctgatctacggcatcctggagaaaccggtgcgttcc
ctgcaggccatcaacatctctgccctccacggggggctgcagagggtgcagctgctaaaa
cccaacatcagcatccctcagctgcccagagacatgaagaccatggagataacagcccca
gatgttgtcattcccagccaggagacgacctactggtgttacatggcagaactcccggag
ggcttccccaagcaccacattatcatgtacgagccagtggtcacggcgggcaacgaggct
cttgtgcaccacatggaggttttccagtgtgcagcccacttcgacagcttccccctctac
aacgggccctgcgactccaagatgaagccagagagactcaactactgcaggcacgtgctg
gcagcctgggccatgggggcacaggctttctattaccctgaagaagcaggtcttgccttt
ggtggcccaggctcctccagatatttgcgtctggagatccattaccacaatcccctggtg
ttcacaggtcgccgtgactcctcggggatccggctgtactacacggccacccttcgtccc
tacgacgctggaatcatggagctgggcttggtgtacacccccgtgatggccattccccct
ggagaggacagcttcatcctcacggggtactgcactgataaatgcacccagctggctctg
cccgctgctggcatccgcatcttcgcctcccagctccacacacacctggcagggaggaaa
gtggtgacggtgctgtcccgggacgggagggagcggcaggttgtgaacgctgatggccac
tacagccctcacttccaggagatccgcatgctgaaggaggtggtcgcagtttttccggga
gatgaactcatcaccacctgcacatacaacaccgaggatcggagcagagccaccgtggga
gggtttggcatcctggaagagatgtgtgtgaactacgtgcactactacccccagacccag
ctggagctgtgcaaaagcgctgtggatccgggctacctgcaccgctacttcaacctcgtc
aacaggtttaacgacgaggagatctgcatgtgcccacaggtgtctgtcccacagcagttt
tactccatcccttggaacacgttcaacagggatgtgctgaaatccctctacggctttgct
cccatctccatgcactgcaacaaatcctccgctgtccgcttcccgggcgagtgggagaag
cagccgctccccagcatcaccgagaggctgcaggagcccagaccccactgctcaccagcc
ccagagccacagcctgctgcccccgtgcccctgcagctgggccagctccacagcgactga

DBGET integrated database retrieval system