KEGG   Taeniopygia guttata (zebra finch): 100224552Help
Entry
100224552         CDS       T01082                                 

Gene name
NCOA3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100224552 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 1400 aa AA seqDB search
MSGLGENSLDSLTSESRKRKPLSCDTPGASLVCSGEKRRREQESKYIEELAELISANLSD
IDNFNVKPDKCAILKETVRQIRQIKEQGKAVSNDDDVQKADVSSTGQGVIDKDSLGPLLL
QALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYGILHEEDRKDFLKNLPKSSV
NGVSWTNETPRQKSHTFNCRMMVKSSRDLVEDVGGYQDIRQRYETMQCFALSQPRAMMEE
GEDLQSCMICVARRITTTERVFPANPESFITRHDLSGKLVNIDTNSLRSSMRPGFEDIIR
RCIQRFLCHNDGQSWSNKRHYHEAYMQGHAETPLYRFSLADGTIVTAQTKSKLFRNPVTN
DRHGFISTHFLQREQNGYRPNPSSVGQNIRTPVTGNTNSVNGLMNMSPGQAMPMQNRNYG
MGDPNAVAQLTSARYGSPGNMGPVNSGPGMQSSAYQSNSFGLNISSPPHGSPGLTSSQQN
LMVSPRNRGSPKMSSHQYSPVTGLHSPMGSASNTSNSTFSSSSLSALQAISEGVGNSLLS
TLSSPGPKLDNSPNISITQQIKTSTQDSKSPSGLYCEQNQVESSICQSNSRDLLSEKDSK
EGNLEASESQRGPSESKGHKKLLQLLTCSSDERGHSTASNSPLDSNCKESSTSVTSPSGV
SSSTSGGVSSSSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTYHDASNTTS
CGEGTIKQEQQSPKKKENNALLRYLLDKDDIKEQLSKELKPKVEGVDNKMGQCTSSTILT
SSQEKEMKIKMEPAEEMNGDLDNLDAILGDLSSSEFYNNAMSANGNNPGTKQAVFQGNAL
GVKSPQSVQTTRPPFNRALSLDSPMGSGASVRNVNAFSMLQKQNLMGGSPRMIENQDNFG
ANLGFAPHKNVAMNQHQPGDWGLPNSKVNRLESASSASMLRAGPEFSTTLQRPGEGGSVS
GLPVRSNSIPGTRPMLQQQMIHMRPNEIDIDMGGNPYGQPGPSNQPGLWPDNMMPMEQAS
RGSQNRQLVRSSLDDLLCSAPNMEGQNDERALLDQLHTLLSNTDVTSLEEIDRALGIPDL
VNQGQALEPKQDSFQGQESSVMIDQKPLLYGQPYQGQGAAMPGCFSNIQGQQPSVNSVMN
QMSQPSNFPLQSMHPRANVMRPRTNTPKQLRMQLQQRLQGQQFMNQTRQTIEIKMENPVS
GTNSVMRPVMQTQVGSQQGFLNAQMVAQRNRELISHHFRQQRMAMMMQQQQQPQAFSPPP
NVTASGSMDSALTGPPMAQVPSQQFPYPPNYGISQQPDPAFSSVSSPPNPMVSSRMGPSQ
NPMLQHPQSATMYQSSEIKGWPSGSIPRNSSFPQQQFSHQGSPAAYSMMHMNGSSGHIGQ
MSINTMPMSGLPMGPDQKYC
NT seq 4203 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggagaaaactccttagatagtttgactagtgagtcaaggaagcgcaag
ccattgtcctgtgatacaccaggtgcaagtctggtctgcagtggtgagaagcgtcgacgt
gagcaggaaagcaaatacattgaagaactggctgagctgatatctgctaatctaagtgac
attgacaatttcaatgtcaaaccagacaaatgtgctattttaaaagaaactgtgagacag
attcgacaaataaaagagcaaggaaaagcagtttctaatgatgatgatgttcagaaagct
gatgtatcatccacgggtcaaggagttattgacaaagattcattgggacctcttttatta
caggcattggatggcttcctctttgttgtaaatcgagatgggaacatagtatttgtatca
gaaaatgtcacacaatatctgcagtataaacaagaagatttggttaatacaagtgtgtat
ggtatcttgcatgaagaggaccggaaggactttcttaaaaacttacctaagtcttcagtt
aatggagtttcttggactaatgaaacacctagacagaagagccatacattcaactgccgg
atgatggtgaaaagctctcgtgacctcgttgaagatgtaggtggctaccaggatattcgt
caaagatatgaaactatgcagtgctttgctttatcgcagccaagagctatgatggaagag
ggggaagatttgcagtcctgcatgatttgtgtggcacgtcgtatcacaactacagaaagg
gtatttccagcaaatccagagagctttattacaagacatgatctttcaggcaaacttgtc
aacattgatacgaactcattacgatcttccatgagacctggcttcgaagatataattcgt
cggtgtattcagagattcttatgccacaatgacgggcagtcatggtcaaataaacgccac
tatcatgaagcttatatgcaaggtcatgctgaaaccccattgtatcgattttctttagcg
gatggtacaatagtgacagcacaaacaaagagtaaactgtttcgaaatcctgtaactaat
gaccgccatggatttatctccacccacttccttcaaagagaacaaaatggatatcggcca
aatcctagttctgttgggcaaaacatcagaacacctgtgactggaaacacaaattctgtt
aatggtcttatgaacatgtcacctggtcaagccatgccaatgcagaacagaaactatggg
atgggagatcccaatgcagtggctcagctcaccagcgctcgatatggaagccctgggaat
atggggccagtgaactctggacctggcatgcagtcctctgcttatcagagtaacagtttt
gggttaaatataagtagcccaccacatggcagtcctggcttaacttccagccaacagaat
ctaatggtatctcctagaaatcgaggcagtccaaaaatgagttcacaccagtattctcca
gttacaggtttgcactcgccaatgggatctgccagcaacactagcaacagcactttctct
agcagttctcttagtgctctgcaagccattagtgagggtgttggaaattcccttttatca
acactttcttcaccgggtccaaaactggataattccccaaacattagtataactcagcaa
attaaaacaagtacccaggactccaaaagcccttctggtttgtattgtgaacaaaaccaa
gtggaaagttccatctgccagtcaaacagcagagatctccttagtgaaaaagatagtaaa
gagggaaatctggaggcatctgaaagtcagagaggaccgtctgagagcaaagggcataaa
aagctccttcagctacttacgtgctcctcagatgaaagaggacattctacagcatcaaac
tcaccattagactcgaattgtaaagaatcttctacgagtgttaccagtccttcaggagtt
tcctcatcaacatctggaggggtatcttcctcctcaaacatgcatgggtcactcctgcaa
gaaaagcacaggattttacataaattgttgcagaatggtaattctccagcagaggtggcc
aagatcacagctgaagctactggtaaagacacatatcatgatgctagtaacacaacctcc
tgtggagaaggcactatcaaacaggaacaacaaagcccaaagaagaaagaaaacaatgct
ttactaagatatctactagataaagatgatattaaggaacagctttccaaagagttgaag
cctaaagtagaaggtgtggataataagatgggacaatgcacaagttctacaattcttact
tcaagtcaagaaaaagagatgaaaataaaaatggagccagcagaggagatgaatggagac
ttggataatttggatgcaattctaggtgatcttagtagttcagagttttacaataatgct
atgtctgcaaatggaaataaccctggaacaaagcaagcagtatttcaaggaaatgccttg
ggtgtgaagagtccccagtctgtgcagactactcgtccaccttttaacagagccttgtct
ttagacagccctatgggctcaggtgcttcagtgaggaatgtgaatgcattctccatgtta
caaaagcaaaacttgatgggtggaagtccaagaatgattgaaaaccaagacaattttgga
gcaaatctgggttttgctccccacaaaaatgtggcaatgaatcagcatcagccaggagac
tggggtttgccaaactccaaagtgaacagattggaatctgcaagttctgcttcaatgttg
agagcgggacctgaatttagtacaacccttcagaggcccggagaaggtggctctgtgtct
gggctgcctgttcgttctaacagcatacctggtactaggccaatgctgcaacagcaaatg
attcacatgaggccaaatgagatagacattgacatgggaggtaatccctatggacagcct
ggaccttctaaccagcctggactgtggcctgataatatgatgcccatggagcaagcgtca
cggggttcccaaaacagacaattagttagaagctctttggatgatctcttatgttcggca
ccaaatatggaaggccagaatgatgaaagggcacttctagatcagctgcacacactattg
agtaatacagatgtcacaagtctggaagaaattgacagagcattaggaattcctgatctt
gtaaaccaaggacaagctttggaacccaaacaagactcatttcaaggtcaggaatcttca
gttatgattgatcagaagcctttgttgtatggtcaaccctatcaagggcaaggggcagca
atgccaggatgttttagtaacatccagggacaacagccatctgttaattcagtgatgaat
cagatgagccaaccaagcaattttcctctgcaaagtatgcatccccgagcaaacgtgatg
agacctcggaccaacacaccaaagcagctacgcatgcagctccagcagaggctccaggga
cagcagtttatgaatcagacccgtcaaactattgaaataaaaatggaaaatccagtcagt
ggtactaactcagtgatgagaccagttatgcagacacaggtgggatcccagcaaggtttt
cttaatgctcaaatggtggctcagcgtaacagggaactaataagtcaccattttagacaa
cagaggatggcaatgatgatgcagcagcaacagcaacctcaggccttcagtccaccacca
aatgtgacagcctcaggaagcatggatagtgctttgacaggccctccaatggctcaagtt
ccttcacagcaattcccctatccacctaattatggaataagccaacaacctgatcctgca
tttagtagtgtatcaagccctcccaatccaatggtatcgtcaagaatgggaccctcccag
aatcctatgctgcagcatcctcagtcagcaacaatgtaccagtcctcagagataaagggc
tggccctcaggaagcatccccagaaacagttcttttccccagcagcagttcagccatcaa
ggtagcccagcagcatacagtatgatgcacatgaatggcagcagtggccatattggacag
atgagtattaataccatgcctatgtcaggactgcctatgggtccagaccagaaatactgc
tga

DBGET integrated database retrieval system