KEGG   Taeniopygia guttata (zebra finch): 100224619Help
Entry
100224619         CDS       T01082                                 

Gene name
USP49
Definition
ubiquitin specific peptidase 49
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
26
AA seq 726 aa AA seqDB search
MDRCKHVGRLRLAQDHSILNPQKWQCVECHTTESLWACLKCSHVACGRYIEEHALRHFQE
TQHPLAMEVHELYVFCYLCQDYVLNDNPEGDLKLLRSSLVAIKGQRGGRTLRSTALPEDA
WRRRSPQGQSQMLTALWHRRQALLARALRTWFHKSSRGQLKLKEKKQMEELEKKKEAARQ
RRQEMKRQLLEELASTPPRKSARLLSHVHGESLIPRKFREVATASPTSRQVQSSRLKQFY
SIRRQPLMTPGVTGLRNLGNTCYMNSILQVLSHLQKFRECFLTLDLCETEELLAKTVNGR
ARMPGRLANGAAAHEPGRPDRVGTQSSPASLNGGSSISRSLELIQPKEPSSKHISLCHEL
HTLFRVMWSGKWALVSPFAMLHSVWSLIPAFRGYDQQDAQEFLCELLDKVQQELESEGSK
RRILIPFSQRKLTKQVLKVVNTIFHGQLLSQVTCRTCNYKSNTVEPFWDLSLEFPERYHA
LEKGLLPVPQAECLLTEMLAKFTETEALEGRIYACDQCNSKRRKSSPKPLVLSEAKKQLL
IYRLPQVLRLHLKRFRWSERNHREKIGVHVLFDQVFGCTAMTRFWVHCNDSKLNVCSVEE
VCKTQAYILFYTQRTPQDTAGIPQKRLQTQAVSGQQQLCSLLPTPLPAGIDPRSAAILRR
KAKIELSYQQFSLSIAVVATMLLQKEPSMEAALGLALRANLRQCRMHHLQQLQDFIDSLD
SDPAGL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggatagatgcaaacatgtggggcggctacgactcgcccaggaccactcgatcctgaac
ccgcagaagtggcagtgcgtggagtgccacaccaccgagtcgctctgggcctgcctcaag
tgctcgcacgtggcctgcgggcgctacatcgaggagcacgccctgaggcacttccaggag
acccagcaccccttggccatggaggtgcacgagctctacgtcttctgttacctctgccag
gactacgtgctgaacgacaaccccgagggcgacctgaagctgctgaggagctccttggtg
gccatcaaggggcagaggggcgggaggacgctgcgctccacggcgctgcccgaggacgcc
tggcgcaggaggagccctcagggccagtcccagatgctgacggcgctgtggcaccgccgc
caggccctgctggcgagggccctgcgcacctggttccacaagagctcccggggacagctg
aagctgaaggagaagaaacagatggaggagctggagaagaagaaggaggcggctcggcag
cggcggcaggagatgaagaggcagctcctggaggagctggccagcacgccgccgaggaag
agcgccaggctgctgtcccacgtgcacggggagagcttgatcccaaggaaattcagggag
gtggccacagcttcccctacctcaaggcaggtgcagagcagcagattgaagcagttctac
tccatccggcggcagcccctgatgacgcccggggtgacggggctgaggaacctgggcaac
acttgttacatgaactccatcctgcaggtgctcagccacctccagaagttccgagaatgt
ttcttgactcttgatctctgtgaaacggaagaacttttagctaaaactgtgaacggcagg
gccaggatgcccggcaggctggccaacggggccgccgctcacgagccggggaggcctgac
agggtgggcacgcagagctcgccggccagcttgaacggcggctcctccatcagcaggagc
ctggagctgatccagcccaaggagcccagctccaagcacatctccctctgccacgagctg
cacaccctgttcagggtgatgtggtccggcaagtgggccctggtgtcgcccttcgccatg
ctgcactccgtgtggagcctgatcccggccttccgcggctacgaccagcaggacgctcag
gagttcctctgcgagctcctggacaaggtccagcaggagctggagtccgagggcagcaag
cgcaggatcctcatccccttctcgcagaggaagctcaccaagcaggtcctcaaggtggtc
aacaccattttccacgggcagctgctcagccaggtcacctgcaggacgtgcaactacaaa
tccaacacggtggagcccttctgggacctttccctggaattcccggagcggtaccacgcc
ctggagaagggattgctgcccgtgccccaggctgagtgcctgctgaccgaaatgttggcc
aaattcaccgagacagaagccctggaggggaggatctacgcctgtgaccagtgcaacagt
aaacggcgaaaatcttctcccaaacctcttgttctgagtgaagctaaaaagcagttgctg
atctacagactacctcaggtcctccggctgcaccttaaacgcttcaggtggtctgagcgc
aatcaccgcgagaagatcggggtccacgtgctgtttgaccaggtttttgggtgcactgca
atgactcgtttttgggtgcactgcaatgactccaaactgaatgtatgtagcgtggaggag
gtgtgcaagacccaggcctacatcctcttctacactcagagaacgccgcaggacacagca
ggaatcccccaaaaacggctccaaactcaggctgtgtctggccagcagcagctctgctcc
ctgctccccacaccgctcccggccggcatcgatccccgctccgccgccatcctcaggagg
aaggcaaagatcgagctgtcgtaccagcagttcagcctgagcatcgccgtggtggccacg
atgctgctgcagaaggagccctcgatggaggcggcgctggggctggcgctcagggccaac
ctccgccagtgccgcatgcaccacctgcagcagctgcaggatttcatcgacagcctcgac
tcggaccccgccggcctctga

DBGET integrated database retrieval system