KEGG   Taeniopygia guttata (zebra finch): 100224677Help
Entry
100224677         CDS       T01082                                 

Definition
TGF-beta receptor type-2-like
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100224677
   04350 TGF-beta signaling pathway
    100224677
   04068 FoxO signaling pathway
    100224677
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100224677
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100224677
  Cell communication
   04520 Adherens junction
    100224677
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100224677
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [Table]
   100224677
Enzyme-linked receptors [BR:tgu01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   100224677
Cytokine receptors [BR:tgu04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   100224677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 559 aa AA seqDB search
MTGTSTAALTCSPLCSSAWGASARRSLKTNLCKWCDSTAPACKEKLCYSNCNLNSYCEDP
YEICVAIWRQDNESIRISTLCHNPHHPIENLMVPNYNTSRCIMSHQPSEDGIIYICGCVD
EQECNDKLIFENHTNGYSMLQSKEVIPVAAISLLPPLLVAVMITVIFYLCRTQKRHKRAK
AWGGKQGQPPVLPEQGKAAEREEKLTVLMDESPASSSHPAELLPIELDEMVGKGQFAEVW
RAKLSHSRSGQYETVAVKIFPCEEYSSWKNESQIFTDTSLRHDSVLQFLTAEDRGTGPRR
EYWLITAYHSRGNLKDYLSHHVLSWMDLQKMAGSLVSGVAHLHSDYTACGRPKIPIAHRD
IKSTNVLVKDEQECVLCDFGIAIRLDPSLTVDDFANSGQVGTARYMAPEVLESRVNLEDL
ESFKQMDVYSMALVLWEMASRCEVVGEVKNYELPFGSKVQEQPCVDTMRDIVLHGRGRPE
IPSSWLVHQGMRFLCDTITECWDHDPEARLTAHCVAERFNLMAQMDCDDILNNNMDNEAS
KTASPGGELQDSDGSRNIQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgactgggacgagcacggccgcgctcacctgcagccctctctgctcctcagcctggggt
gccagcgcccggcgcagcctcaagaccaacctgtgcaagtggtgcgactccaccgctccg
gcctgcaaggagaagctgtgctacagcaactgcaacctcaactcctactgcgaggacccc
tacgagatctgcgtggcaatatggagacaggacaacgagagcatcaggatcagcacgctc
tgccacaacccccaccaccccatcgaaaacctcatggtccccaactacaacacctcccgc
tgcatcatgagccaccagcccagcgaggatggcatcatctacatctgtggctgtgtggat
gagcaggagtgcaacgacaaactcatctttgaaaaccacaccaatggctactccatgctg
cagagcaaagaggtgatcccagtggctgccatcagcctgctgcccccgctgctggtggcg
gtgatgatcacggtgatattttacctctgccgcacgcagaagcgacacaagagagccaag
gcgtggggtgggaaacagggacagcccccagtgctgccggagcaggggaaggcagctgag
cgggaggagaagttgaccgtgctgatggatgagagcccggccagcagcagccaccccgct
gagctgctccccatcgagctggacgagatggtgggcaaggggcagttcgcggaggtctgg
agagccaagctgagccacagccgctccgggcagtacgagaccgtggccgtgaagatcttc
ccctgcgaggaatactcctcctggaagaacgagagccagatcttcaccgacaccagcctc
aggcacgacagcgtcctgcagttcctcactgctgaggaccggggcacagggccccgccgg
gagtactggctcatcaccgcctaccacagccgaggcaacctcaaggactacctctcccac
cacgtgctgagctggatggacctgcagaagatggctgggtccctggtgagtggggtggcc
caccttcacagcgactacaccgcatgcggccgcccgaaaatccccatcgcccaccgcgac
atcaagagcacaaacgtcctggtgaaggacgagcaggagtgcgtgctctgcgacttcggc
atcgccatacgccttgacccctccctgacagtggatgactttgccaacagtgggcaggtg
ggcactgccaggtacatggccccagaggtcctggagtccagagtgaacctggaagacctg
gagtcttttaagcagatggatgtctactccatggcccttgttttgtgggaaatggcctcc
agatgtgaagtggtaggagaggtaaagaattatgagctaccttttgggtcaaaagtccag
gagcagccttgtgtggacaccatgagggacatcgtgctgcatggcagaggccggcccgag
atcccaagcagctggctggtgcaccagggaatgcgcttcctgtgcgacaccatcacggag
tgctgggaccacgaccccgaggctcggctcaccgcccactgcgtggctgagcgcttcaac
ctgatggcacagatggattgtgatgacatcctcaacaacaacatggacaatgaggccagc
aaaacagcttctccaggtggggagctccaggacagtgatgggagcagaaacattcagtga

DBGET integrated database retrieval system