KEGG   Taeniopygia guttata (zebra finch): 100224780Help
Entry
100224780         CDS       T01082                                 

Gene name
RXRG
Definition
retinoid X receptor, gamma
Orthology
K08526  
retinoid X receptor gamma
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
PPAR signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    100224780 (RXRG)
   03320 PPAR signaling pathway
    100224780 (RXRG)
Transcription factors [BR:tgu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100224780 (RXRG)
Nuclear receptors [BR:tgu03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100224780 (RXRG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 468 aa AA seqDB search
MYGNYPHFIKFPAGFGNSPVHASSTSVGLSSGLPTGSPVVEGPPSYLEPPGTAARALPSP
MGAVGSPVSALGSPYRVIASSLGSHPVALSSAPGMNFVAHASPQLNVLNNVSSSEDVKPL
PGLPGMGNMNYPSTSPGSLAKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTC
RDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRSRERSENEAESTSSGSEDMP
VERILEAELAVEPKTEAYSDVGTESSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTL
EDQVILLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELV
SKMKDMQMDKSELGCLRAIVLFNPDAKGLSSPSEVESLREKVYATLEAYTKQKYPEQPGR
FAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQVT
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtatgggaattatcctcacttcattaagtttcctgcgggctttggcaattccccggtg
cacgccagctccacgtctgtgggcctgtcctcgggccttcccacggggagcccggtggtg
gaggggccccccagctacctggagccccccgggaccgctgcgagggcgctgccgtcgccc
atgggtgccgtcggctccccggtgagcgccctgggctcgccctacagggtcatcgcctcc
tcgctgggctcccaccccgtcgctctgtcctcggcccccggcatgaatttcgtggcacac
gccagcccacagctcaatgtcctgaacaatgtcagcagctcggaggatgtcaagcccttg
ccgggtctcccggggatggggaacatgaattatccatccacgagtccaggatccctagcc
aaacacatctgtgccatctgtggggacaggtcctcagggaagcactatggggtgtacagc
tgtgagggctgcaaaggcttcttcaagaggacgatcaggaaggatctgatctacacctgc
cgggataacaaggattgcctgatcgacaagcgccagcgcaaccgctgccagtactgccgc
tatcagaagtgcctcgccatggggatgaagagggaagctgtgcaggaggagaggcagagg
agcagggagcgcagtgagaacgaggccgagtccacgagcagtggcagtgaggacatgccc
gtggagaggatcctggaagctgagctggcagtggagcccaaaacagaggcatacagtgac
gtgggcacagagagctcgacaaatgacccagtcaccaacatctgccacgctgctgacaag
cagctcttcacactggtcgagtgggccaagcgcatcccccacttctccgacctgacgctg
gaagaccaagtcattctcctccgggcaggctggaatgagctgctcattgcctctttctcc
catcgctccgtgtcagtccaggacgggatcctgctggccacgggcctgcacgtgcaccgc
agcagtgcccacagcgctggcgtgggctccatctttgacagggttttgacagagctggtg
tccaaaatgaaagacatgcagatggataagtcggagctggggtgcctgcgagccattgtc
ctgtttaacccagatgccaagggtctgtccagcccctcagaagtggaatctctccgggag
aaggtctatgccacgctggaagcctacacgaagcagaagtaccccgagcagccaggacgg
tttgccaaactcctcctgcgcctgccggcgctgcggtccatcgggctgaagtgcctggag
cacctcttcttcttcaagctgattggagacacccccatcgacacctttctcatggagatg
ctggagacacccctgcaggtcacttga

DBGET integrated database retrieval system