KEGG   Taeniopygia guttata (zebra finch): 100224793Help
Entry
100224793         CDS       T01082                                 

Gene name
ARHGAP5
Definition
Rho GTPase activating protein 5
Orthology
K13709  
Rho GTPase-activating protein 5
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    100224793 (ARHGAP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 1505 aa AA seqDB search
MMAKNKEPRPPSYAVSVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTI
DFGGRVVNNDHFLYWGDVAQSGEDGIECRIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNIDGFLLCIDVSQGCNRKFDDQLKFV
NNLYIQLSKSKKPIIIAATKCDECVDHYLREVQAFASNKKNLVVVETSARFNVNVETCFT
ALVQMMDKTRGKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNH
PDYEEYINLEGTKKAKNTFSKHIEQLKQEHIRKRKEEYINALPRALNTLLSNLEEIELLS
WSEALKVMEKRPDFQSCFVVLEKTPWDETDHIDKVNDRRIPFDLLSTLEAEKVYQNHVQH
LISEKRRVEMKEKFKKTLEKIQLISPGQPWEEVICFVVEDEAFKYITDADSKEVYARHQR
EIVEKAKEEFQEMLFEHSELFYDLDLNATPSTDKMSEIHAVLSGEPRYKALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQNCMDIKVEELLANSLLQQDHGRSNLYHDSANIDKINLFI
LGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYLLTQLWTSAFKPHGCFC
VFNSIESLAFIGDCIAKIRAEASQIRRDKYMANLSFTLILANQRDSVSKNLPILRHQGQQ
LANKLQCPFVDVPAGTYPRKFNEAQIKQALRGVLEAVKHNFDVVNPVPTIKDLSEADLRI
VMCAMCGDPFSVDLILSPFLDSHSCSAAQAGQSNSLMLDKIIGEKRRRIQITILSYHSSI
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKEL
MTEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIESSYMSDSTRESTHT
SEDVFPRSPRGGSLDYNYPDSEDDAEGPPPYSPIGDDVRLLPAPSDRSKYRLDLEGNEYP
VHSTPINCHDHERNHKVPPPIKPKPLVPRTNVKKLDPNLLKTIEAGIGKNPRKQPSRVPA
VPPEDIDPSDNYAEPIDTIYKHKGFADDIYAVPEDSQNRIIKVRNSIVISSQGEEENGFS
DRVSKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTCKGKKKGRHRGSEED
PLLSPVETWKGGIDNPAITSDQELDEKKGKKKPHKVKEDKKPKKKTKTFNPPIRRNWESN
YFGMPLQDLVTPEKPIPLFVEKCVQFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNI
SLESMGVTVNAVAGALKAFFADLPDPLVPYSLHQELLETSKIMDKTERLHELKEIVKKFH
PVNYDVFRYIITHLNRVSQQYKTNYMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVI
ETFIQQCQFFFYNGEIVEAPNPVACQPPPSNPVQMVEPMVPLQLPPPLQPQLIQSQLPAD
PLGII
NT seq 4518 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaaaaacaaagagccacgccccccatcttatgctgttagtgttgttggactg
tctggaactgaaaaggataaaggtaattgtggagtcggaaagtcatgtttgtgcaataga
ttcgttcgttcaaaagcagatgaatattatcctgagcatacctctgtgcttagcacaatt
gactttggaggaagagttgttaacaatgatcactttttgtactggggtgacgtagcacaa
agtggtgaggatggaattgagtgcagaattcatgtaattgagcagactgaattcattgac
gatcagactttcttgcctcatcggagtacgaatttacaaccgtacataaaacgtgcagct
gcctccaaactgcagtccgcagaaaaactaatgtacatttgcacagatcagctaggcttg
gagcaagactttgagcaaaaacaaatgcctgaagggaaattaaacatagatgggttttta
ttgtgcattgatgtaagccaaggatgcaataggaagtttgatgatcaacttaaatttgtg
aataatctttatatccagctctcaaaatctaaaaaacctataataatagcagcaacaaaa
tgtgatgaatgtgtggatcattatctacgagaggttcaggcctttgcttcaaataagaag
aaccttgtggtcgtggaaacatcagcaagattcaatgtcaatgttgaaacatgttttact
gcactggtacaaatgatggataaaactcgtggtaaacctaaaataatcccctatctggat
gcctataaaactcaaagacagttagttgttacggcaacagataagtttgaaaaacttgtc
caaactgtgagagactatcatgcaacttggaaaactgttagtaacaaactgaaaaaccac
cctgattatgaagagtacataaatttggaaggaacaaaaaaggccaaaaatacattttca
aaacacatagagcaacttaaacaggagcatattagaaagaggaaagaagaatacattaat
gcattgccaagagctcttaatactcttctgtcaaatcttgaggagattgaacttttgagc
tggtcagaagccttgaaggtaatggagaaaaggcctgacttccagtcctgttttgtagtg
cttgaaaaaacaccctgggatgaaactgaccacatagataaagtgaatgacagaaggatt
ccatttgaccttctcagtaccctagaggcagaaaaagtttatcaaaaccatgtgcaacat
cttatatcagaaaaaaggagagttgaaatgaaagagaaattcaaaaaaactcttgagaaa
atccaattaatttcacctggacagccatgggaagaagttatatgttttgtggtggaggac
gaagcattcaaatacatcactgatgcagatagtaaggaagtgtatgctaggcatcagagg
gagattgttgaaaaagccaaagaggagtttcaggaaatgctttttgaacattcagagtta
ttttatgatctggatcttaatgcaacaccaagtacagataaaatgagtgaaattcatgca
gttctgagtggagaacctagatacaaagctttacagaaacttgcacctgatagagaatct
cttctgctcaagcatataggatttgtttatcacccgactaaagaaacttgtctcagtggc
caaaactgcatggacataaaagtagaagagttacttgccaacagtcttctgcaacaagac
catggacgctcaaatttataccatgatagtgccaacattgataaaatcaatcttttcatt
ttgggcaaagatggccttgcacaagaattggcaaatgaaattaggacacaatccactgat
gatgaatatgcattagatggaaaaatatatgaactagatcttaggccagttgatgccaaa
tccccttacttgctgactcagttgtggacctcagccttcaaaccgcatggttgtttctgc
gtgtttaactctattgaatcactggcttttattggggactgcattgcaaaaataagggct
gaagcatctcagataaggagagacaagtatatggctaatctttcatttacattaatattg
gctaaccagagggacagtgttagcaagaatctacctattctgagacatcagggacagcaa
ctggctaacaagttacagtgtccttttgtagatgtgcctgctggtacatacccacgcaag
tttaatgaggcccaaataaaacaagctctgaggggagtactagaagcagttaaacacaat
tttgatgttgtaaatccagttcccaccattaaagatctgtcagaagctgacttaaggatt
gttatgtgtgccatgtgtggcgatccgttcagtgtggatcttattctttcacctttcctt
gattctcactcctgtagtgctgctcaggctggccagagtaattctttaatgcttgataaa
ataataggtgaaaagagacgtagaatacagataactatattgtcatatcattcttcaatt
ggtgtaaggaaagatgaacttgttcatggatacatactggtctattctgcaaagcgaaag
gcatccatgggaatgcttcgggcatttctttctgaagttcaggatactattcctgtccag
ttggtggctgttactgatagccaagcagacttctttgagaatgaagcaatcaaggaactc
atgactgaaggagaacacatagcaacagaaattactgctaagtttacagctttatattca
ttatctcaatatcatcgtcaaactgaggttttcacattgttcttcagtgatgtattagag
aagaaaaacatgattgaaagttcctacatgtcagacagcacaagggaatcaacgcataca
agtgaagatgtttttccaagatctccgagaggaggttcccttgactataattacccagat
tcagaggatgatgctgaaggaccaccaccttacagtccaattggtgatgatgtaaggtta
cttccagcacctagcgatcgttcaaagtaccgactggatttggaaggaaatgagtatcct
gttcacagtacaccaatcaattgtcatgaccatgagcgcaaccataaagtgcctcctcca
ataaaaccgaaaccacttgttccaagaacaaatgtgaaaaaactggatcctaacctcctg
aaaacaattgaggcaggtattggcaaaaaccccaggaaacagccttctcgagtgcctgca
gtgccaccagaagatatagacccatctgacaactatgctgaacctattgacacgatttac
aaacataaaggctttgcagatgacatctatgcagttccagaggatagtcagaatcgtatt
attaaagttcgaaactcaattgttataagtagccaaggtgaggaagaaaatggattttct
gacagagtatccaaaagtcatggggaaagaaggccttcaaaatacaagtacaagtctaag
acgctgttcagcaaagccaagtcttactataggagaacacattcggacgcaagtgatgat
gaggcttttaccacctgtaaaggtaaaaaaaaaggaaggcatcgtggaagtgaagaagac
ccacttctttcccctgttgaaacttggaagggtggcatagataatcctgctattacatcg
gaccaagaattggatgagaaaaaagggaaaaagaaaccccacaaagtaaaagaagataag
aagccgaaaaagaaaactaagacattcaatcctccaatccgtagaaactgggaaagtaat
tactttgggatgcccctacaggatttggttacacctgagaaaccaatacctctgtttgtt
gaaaaatgtgtgcaattcattgaagatacaggattatgtactgaaggcctgtaccgtgtt
agtgggaataaaacagatcaagacaacattcaaaaacagtttgatcaagatcataatatt
agtctagaatcaatgggagtaacagtgaatgctgtggctggggctctgaaagcttttttt
gcagatctgccagatccattagttccttactctttgcatcaagagttgttagaaacatcg
aaaatcatggataagacagaacggctacacgagttaaaagagattgtgaagaaattccac
ccagtgaactatgatgtcttcagatacataataacacatctaaacagggttagtcagcaa
tataagaccaactatatgactgctgataacttatccatttgtttctggcctactttgatg
agacctgattttgaaaacagagagtttctttctaccaccaaaatccatcaatcagttata
gagaccttcattcaacaatgtcagtttttcttttacaacggggagattgtagaagcaccc
aacccagtggcttgtcagccgccgccttccaacccagtgcagatggtggagcccatggta
cccctgcagctgccgcccccgctgcagcctcagctgatacagtcgcagttaccagcagac
cctcttggcattatatag

DBGET integrated database retrieval system