KEGG   Taeniopygia guttata (zebra finch): 100224866Help
Entry
100224866         CDS       T01082                                 

Definition
carboxypeptidase A1-like
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     100224866
Peptidases [BR:tgu01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   100224866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1A
AA seq 420 aa AA seqDB search
MRLPVLLAALVAVATCTKTFVGHQVLRVIPQSDEELQKVQELQDLEHLQLDFWLAPRKLG
LPVDIRVPFPSLQAVKAHLEATGVSYSIMIEDVQALLDEEQREMLRSSRQLPLDTTTFNY
DAYHTIDEIYNFMDMLVAENPNLVSKLEIGRSTENRPLYVLKFSTGGTNRPAVWIDTGIH
SREWVTQASGVWFARKIVQDHANNEGVASILETMDIFLEIVTNPDGYAYTHTTDRMWRKT
RSRHSGAICVGVDPNRNWDAGFGDAGASAYSCSETYHGPYPNSEPEVKSIVDFVKSHGNI
KAFVSIHSYSQLLLYPYGYTETPAPNAQELHEISAKAVAALSSLYGTQYEYGSIITTIYR
ASGSTVDWTYNQGIKYSFTFELRDTGRYGFLLPARQIVPTAEETWLALKVIMEHARDNIY
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaggctccccgtgctcttggctgccctggtggcagtggccacctgcaccaagaccttc
gttgggcaccaggtgctgcgcgtcatcccccagagcgatgaggagctgcagaaggtgcag
gagctgcaggacctggagcatctgcagctggatttctggctggctccccgcaagctcgga
ctgcccgtggacatccgcgtgcccttccccagcctgcaggcggtcaaagcccacctggag
gccactggggtctcctattccatcatgatcgaggatgtgcaggccctgctggatgaggag
cagagggagatgctccgcagcagccgccagctgccgctcgacaccaccaccttcaactat
gacgcctaccacaccatagatgagatctataatttcatggacatgctggtggccgagaac
cccaacctggtgagcaagttggagattggccgctcgaccgagaaccgtcccctctacgtg
ctcaagttcagcacagggggcacaaaccgcccggccgtctggatcgacaccgggatccac
tcccgcgagtgggtgacacaggccagcggcgtctggtttgccaggaagattgtccaggat
cacgcgaataacgaaggtgtggcctccatcctggagacgatggacatcttcctggagatt
gtcaccaacccagatggctatgcctacacccacaccacggaccgcatgtggcgcaagacc
aggtccaggcactcgggtgccatctgcgtcggagtggaccccaaccgcaactgggacgca
ggttttggagatgccggagccagcgcatactcctgctcggagacgtaccacggaccctac
cccaactcggagcctgaggtgaaatccatcgtggactttgtgaagagccatggcaacatc
aaggctttcgtctccatccacagctattcccagctcctgctctacccctacggctacacc
gagaccccggcaccaaacgcgcaggaactgcacgagatttctgccaaggccgtggcagct
ctgtcctccctgtacggcacccagtacgagtacggcagcatcatcaccaccatctacaga
gcaagtggatcgaccgttgactggacctacaaccaggggattaaatattccttcaccttc
gagctgcgggacacggggcgctacggattcctgctgcctgccagacagatcgtccccacc
gccgaggagacttggctggctctgaaggtcatcatggagcacgcccgggacaacatctac
tga

DBGET integrated database retrieval system