KEGG   Taeniopygia guttata (zebra finch): 100224866Help
Entry
100224866         CDS       T01082                                 

Definition
carboxypeptidase A1-like
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1A
AA seq 420 aa AA seqDB search
MRLPVLLAALVAVATCTKTFVGHQVLRVIPQSDEELQKVQELQDLEHLQLDFWLAPRKLG
LPVDIRVPFPSLQAVKAHLEATGVSYSIMIEDVQALLDEEQREMLRSSRQLPLDTTTFNY
DAYHTIDEIYNFMDMLVAENPNLVSKLEIGRSTENRPLYVLKFSTGGTNRPAVWIDTGIH
SREWVTQASGVWFARKIVQDHANNEGVASILETMDIFLEIVTNPDGYAYTHTTDRMWRKT
RSRHSGAICVGVDPNRNWDAGFGDAGASAYSCSETYHGPYPNSEPEVKSIVDFVKSHGNI
KAFVSIHSYSQLLLYPYGYTETPAPNAQELHEISAKAVAALSSLYGTQYEYGSIITTIYR
ASGSTVDWTYNQGIKYSFTFELRDTGRYGFLLPARQIVPTAEETWLALKVIMEHARDNIY
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaggctccccgtgctcttggctgccctggtggcagtggccacctgcaccaagaccttc
gttgggcaccaggtgctgcgcgtcatcccccagagcgatgaggagctgcagaaggtgcag
gagctgcaggacctggagcatctgcagctggatttctggctggctccccgcaagctcgga
ctgcccgtggacatccgcgtgcccttccccagcctgcaggcggtcaaagcccacctggag
gccactggggtctcctattccatcatgatcgaggatgtgcaggccctgctggatgaggag
cagagggagatgctccgcagcagccgccagctgccgctcgacaccaccaccttcaactat
gacgcctaccacaccatagatgagatctataatttcatggacatgctggtggccgagaac
cccaacctggtgagcaagttggagattggccgctcgaccgagaaccgtcccctctacgtg
ctcaagttcagcacagggggcacaaaccgcccggccgtctggatcgacaccgggatccac
tcccgcgagtgggtgacacaggccagcggcgtctggtttgccaggaagattgtccaggat
cacgcgaataacgaaggtgtggcctccatcctggagacgatggacatcttcctggagatt
gtcaccaacccagatggctatgcctacacccacaccacggaccgcatgtggcgcaagacc
aggtccaggcactcgggtgccatctgcgtcggagtggaccccaaccgcaactgggacgca
ggttttggagatgccggagccagcgcatactcctgctcggagacgtaccacggaccctac
cccaactcggagcctgaggtgaaatccatcgtggactttgtgaagagccatggcaacatc
aaggctttcgtctccatccacagctattcccagctcctgctctacccctacggctacacc
gagaccccggcaccaaacgcgcaggaactgcacgagatttctgccaaggccgtggcagct
ctgtcctccctgtacggcacccagtacgagtacggcagcatcatcaccaccatctacaga
gcaagtggatcgaccgttgactggacctacaaccaggggattaaatattccttcaccttc
gagctgcgggacacggggcgctacggattcctgctgcctgccagacagatcgtccccacc
gccgaggagacttggctggctctgaaggtcatcatggagcacgcccgggacaacatctac
tga

DBGET integrated database retrieval system