KEGG   Taeniopygia guttata (zebra finch): 100224891Help
Entry
100224891         CDS       T01082                                 

Gene name
ASNS
Definition
asparagine synthetase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tgu00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 561 aa AA seqDB search
MCGIWALFGSDECLSVQCLSAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAVVDQLYGMQ
PIRVKKFPYLWLCYNGEIYNFKQLQKQFGFDFQTLVDGEVILHLYNRGGIEQTASMLDGV
FAFILLDTANRKVFLARDTYGVRPLFKVLTDDGFLGVCSEAKGLINLKHSTSLCSKVEPF
LPGHYEVLDLKPSGKVASVELVKFHSCKDEPLHVVCDTVEALPSGFDLETVKSNIRILFE
NAVRKRLMAHRRIGCLLSGGLDSSLVAAVLLKLMKEMNINYPLQTFAIGMENSPDLLAAR
KVAAHIGSEHHEVILNTEEGIQAIEDVIFSLETYDITTIRASIGMYLVSKYIRKKTDSVV
IFSGEGSDELTQGYIYFHKAPSPEEAAEESERLLKELYLFDVLRADRTTAAHGLELRVPF
LDHRFTSYYLSLPAELRIPKNGIEKYLLRLSFEDSNILPKEILWRPKEAFSDGIASVKKS
WFSILQDYIDQQVDDLLLEKAAEKYPFNPPKTKESYYYRQIFEKHYSGRSSWLPHYWMPR
WVKATDPSARTLKHYKSATQE
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatctgggccctgtttgggagtgatgagtgcctttctgtgcagtgtctgagt
gccatgaagatagcacacagaggtcctgatgcatttcgttttgagaacgtcaatggtttc
accaactgttgttttggtttccaccggctggcagttgttgatcagctatatggtatgcag
cctatccgggtgaagaaattcccatacctgtggctgtgttacaatggagaaatctacaat
ttcaaacagctgcagaagcagtttggatttgactttcaaacattagtggatggtgaagtt
atccttcatctatataacagaggaggaatagaacaaacagcatccatgctagatggtgta
tttgctttcatccttctggacactgcaaacagaaaagtgtttctggcaagagatacctat
ggagtcagaccactgtttaaggtgctgactgatgatggatttttgggtgtctgttcagag
gcaaaaggacttatcaacctaaagcattcaacatccttatgttctaaagtggaacctttt
cttccgggtcattatgaagtgttggacttaaagccctctggcaaggttgcatcagtggaa
ttagtaaaatttcatagctgtaaagatgaaccactccatgttgtatgtgatacagtggaa
gctctgccttcaggttttgaccttgaaacagtgaaaagcaacatccgtattctctttgaa
aatgctgttagaaaacgtttgatggctcacagaaggattggctgtcttctgtcagggggc
ttagattccagcttggttgcagctgttcttctgaaactgatgaaagaaatgaacatcaat
tatccattacaaacctttgcaattggaatggaaaacagtcctgacttacttgcggccaga
aaggtggcagcacatataggcagtgaacatcatgaagtaatacttaatactgaagagggg
attcaggcaatagaggacgttatcttctcattggaaacctacgatataacaacaataaga
gcttctattggtatgtatcttgtctccaaatatattcggaagaaaacagacagtgtggtc
attttttcgggagaaggatcagatgagctaacacaaggatatatatatttccataaggcg
ccatctcccgaggaagcagcagaagagagtgagaggcttctgaaggagctctacctgttt
gatgtacttcgtgcagacagaactactgcagcacatggccttgaactgagagtcccattt
ttggatcatcggtttacttcttattatttgtctctgccagcagaactgcgaatcccaaag
aatggaattgaaaaataccttttaagattgtcctttgaggattccaatatacttcccaaa
gaaattctctggagacccaaagaagctttcagtgatggcatagcatcagtaaagaaatcc
tggttttccattcttcaggactatattgaccaacaggttgatgaccttttactggagaag
gcagcagagaaatatcctttcaatcctcctaaaacaaaagaaagttattactaccgccag
atctttgaaaagcactactcagggcggagcagctggctgccccactactggatgccaaga
tgggttaaagctactgatccctctgcacgcacactgaaacattacaagtctgctacccaa
gaatag

DBGET integrated database retrieval system