KEGG   Taeniopygia guttata (zebra finch): 100224899Help
Entry
100224899         CDS       T01082                                 

Gene name
GALC
Definition
galactosylceramidase
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tgu00600]
Cellular Processes; Transport and catabolism; Lysosome [PATH:tgu04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 664 aa AA seqDB search
MILLACSCGPGPPRPAPLRSWRPTYVLDDANGLGREFDGIGAVSGGGATSRLLVNYPEPY
RSQILDYLFKPNFGASLHILKVEIGGDAQSTDGTEPSHMHYENDENYFRGYEWWLMKEAK
KRNPNIKLIGLPWAFPGWIGKGENWPYDYPDITAYYIISWILGAKQYHDLDIDYVGIWNE
RAFSSKYIKVLRHYLDRLGLWNIGIIAADGDWNISKEMLVDPYLNDAIEVVGAHYPGTKT
VQNAILTGKKLWSSEDYSTFNDDVGAGCWARILNQNYVNGNMTSTIAWNLVASYYEELPF
GRCGLMTAQEPWSGHYKVESPIWITAHTTQFTQPGWSYLQVDGHLEGGGSFVALTDGLGN
LTIIIETMSHNHSKCIRPPLPNFNVMPQRATFYLRGSFYMVETLQVWHSRLDFESGNSSL
FQQLHPLQVWEGRFSLDLNVDEVYTLTTLKTGRKCGCPEPPPPQPFPSNYNDDFNIRNPP
FSEAPNFADQTGVFEYFVNASDPGDHVFTLRQVVVQRPITWVSDADQTISVIGNFKWVNM
TVTCDIYIEKPRDGGVFIAGRVDNGGIYVRHSKGVFFWVFADGTYRVTGDLAGKQILMKG
LAGVRDNAWHTLTLNIQGNSASGLLNGYPLWDNVTVSSPGNGWAALGTRSFEFAQFDNFH
VEAC
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgcttgcctgcagctgcggcccggggccccccaggccggcgccgctccgctct
tggcggcccacctacgtgctggacgatgccaacgggttgggcagggagttcgacgggatc
ggggctgtcagcggcggcggggccacatctagactcctagtgaactacccagaaccttat
cgctcccagattttagattacctgttcaagccaaattttggtgcttctttacatattctc
aaggtagagattggaggtgatgcacagtcaacagatggtactgaaccctcccatatgcac
tatgaaaatgatgagaactacttccggggctatgaatggtggctgatgaaagaggctaaa
aagaggaaccccaacattaaactgattgggttaccttgggcatttccaggatggataggg
aagggggaaaattggccctatgactatccagatatcactgcttattatattatttcttgg
atattaggagcaaaacagtatcatgatttggacattgattatgttgggatatggaatgaa
agggcatttagtagcaaatacattaaggtgcttcgacattatttggacagactgggtcta
tggaacattggcatcatcgctgcggatggagattggaacatctcaaaagagatgctagtt
gatccctatcttaatgatgctattgaggtagtcggggctcactatcccgggacaaaaaca
gtgcaaaatgccatattaactggaaagaaactgtggtcatcagaagattacagtactttc
aatgatgatgttggtgcaggctgctgggctcggatcctgaaccaaaactacgtgaatgga
aacatgacctcaaccattgcatggaacctggtggctagttattatgaagagctgcccttt
ggtcgatgtgggttaatgacagcacaggagccgtggagtggccactataaagttgaatct
cctatctggataacagcacacaccacacagtttactcagccaggctggtcatacttgcaa
gtagatggacacttagaaggaggtggcagttttgtagctctgacagatggcctagggaac
cttaccatcatcattgaaactatgagtcataatcactctaaatgtatcaggcctccattg
ccaaatttcaatgtcatgcctcagagagcaactttctacctcagagggtcattttatatg
gtggagacccttcaagtgtggcattctagacttgattttgaatctggaaactccagtctt
ttccagcaactccatcctttacaggtatgggagggaagattttctttagatctaaatgtg
gacgaagtctacactttaaccacactcaagacaggacggaaatgtggttgcccagagccg
cctcctcctcagccctttccttccaattacaatgatgatttcaatatacgtaatccacct
ttcagtgaagccccaaatttcgcagatcagacgggtgtatttgaatattttgtaaatgct
tctgacccaggagatcatgtgttcacactccgccaggtggtggttcagcggcccatcact
tgggtttctgatgcagaccagaccatcagtgtcataggaaattttaagtgggtaaacatg
actgtcacttgtgacatctacatcgaaaaacctcgtgatggaggcgtgtttattgcagga
agagttgacaatggtgggatatatgtgcgacattccaaaggagttttcttctgggttttt
gcagatggcacctatagagtcactggtgacctagctggaaaacaaatattaatgaaagga
cttgctggtgtccgggataatgcgtggcacacacttactctcaacattcagggtaactct
gcctcaggactgttaaacggttatccgctctgggacaatgtcaccgtttccagcccgggg
aatggctgggctgcccttggaactcgctcctttgagtttgcacagtttgacaactttcac
gttgaagcttgctga

DBGET integrated database retrieval system