KEGG   Taeniopygia guttata (zebra finch): 100224900Help
Entry
100224900         CDS       T01082                                 

Gene name
BCL2L1
Definition
(RefSeq) BCL2-like 1
  KO
K04570  
Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Protein phosphatases and associated proteins [BR:tgu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100224900 (BCL2L1)
Chromosome [BR:tgu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100224900 (BCL2L1)
Transporters [BR:tgu02000]
 Other Transporters
  Pores ion channels [TC:1]
   100224900 (BCL2L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
20
AA seq 229 aa AA seqDB search
MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDGVLNGSPSWHAATSH
IVNGATVHQNSLEVHEIRRAADVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSF
EQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVLVKRIVSWMTTYLTDHLDPWIQ
ENGGWERFVDSMERCCCRDEKRPGDFNKWLLTGATVAGVLLLGSLLSRK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtacagcagtaaccgggagttagtgattgactttgtttcctacaagctctcacagaaa
ggatacagctggagtcagctggaagaggaggatgagaacaggactgactttgcaggggag
gaggacgagatggacggggtcctcaacgggagcccctcctggcacgcggccaccagccac
atagtgaatggagccaccgtgcaccagaacagcctcgaagtccatgagatccgtcgagca
gctgatgtgaggcaggcgctgagagaggcgggggatgagtttgagctgaggtaccggcgg
gcgttcagcgacctcacttcccagctccacatcactcccagcacagcgtatcagagcttt
gagcaggtagtgaacgaactgttccgcgatggagtgaactggggccgcatcgtggctttc
ttctccttcggaggagccttgtgcgtggagagcgttgttaaggagatgagggtattggtg
aaacgcatcgtctcttggatgaccacgtacttgaccgaccacttagatccctggatccag
gagaatggcggatgggagcgctttgtggactctatggaacgatgctgctgccgagatgag
aaaaggccaggagacttcaacaaatggctcctgacgggggcgacggtggccggagtgctt
ctgctgggatccctgctgagccgcaagtga

DBGET integrated database retrieval system