KEGG   Taeniopygia guttata (zebra finch): 100224916Help
Entry
100224916         CDS       T01082                                 

Gene name
ACSS2
Definition
(RefSeq) acyl-CoA synthetase short-chain family member 2
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100224916 (ACSS2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100224916 (ACSS2)
   00620 Pyruvate metabolism
    100224916 (ACSS2)
   00640 Propanoate metabolism
    100224916 (ACSS2)
Enzymes [BR:tgu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     100224916 (ACSS2)
Lipid biosynthesis proteins [BR:tgu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   100224916 (ACSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 606 aa AA seqDB search
MMIQVYPPVLEPLFYMGQEQSLYQLSCFSREGNEPGDSTKITYRELLHKVCQFANVLRSQ
GVQKGDRVSIYLPMILELVVAMLACARIGALHSVVFAGFSAESLCERILDCGCSLLITAD
AFYRGDKLVNLKQIADEAVRKCIDKGSSLKKCIVVKHLGREEVAVDGTCSKSPPLKRLCQ
EVQTPWNPATDVWWHELMRGASTECEPEWCDAEDELFILYTSGSTGKPKGVLHTVGGYMI
FAATSFKYVFDYQAEDVYWCTADIGWITGHSYLTYGPLANGATSVLFEGVPTYPDVGRMW
SIIDKYKVTKFYTAPTAIRLLMKYGEEPVKKHSRKSLKVLGTVGEPINPEAWLWYYRVVG
EERCPIVDTFWQTETGGHMLTPLPAATPMKPGSATFPFFGVVPAILSESGEELEGEAEGY
LVFKQPWPGIMRTLYGKHQQFETIYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVS
GHLLSTAEVESALVEHTAVAEAAVVSHPHPLKGECLYCFVTLREGHEFTKNLADELKKQV
REKIGPIATPDYIQYAPSLPKTRSGKITRRILRKIAKNDQDLGDISTLADPGIIKHLFSS
RCDTKQ
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgatgatccaggtgtacccaccagttttggaacccctgttctacatggggcaggagcag
agcttgtatcaattatcttgcttttccagggaagggaatgaacctggggattccacgaag
atcacctaccgtgagctgctgcacaaagtttgccagtttgccaatgtcctccgcagccaa
ggggtgcagaaaggagaccgggtttccatctacctgccaatgatcctggagctcgttgta
gccatgctcgcctgtgccaggattggagctctgcactctgttgtgtttgcaggtttctct
gcagaatccctttgcgagcggatccttgactgtggttgctctctcctcatcacggcagat
gccttttatcgaggggacaaactggtcaacttgaagcagattgcagacgaagccgtccgg
aaatgtatagacaagggatcctctttgaaaaagtgcatcgtggtgaagcacctgggcagg
gaagaagtagcagtggacgggacctgcagcaaatctcctcctctgaaaaggctgtgccag
gaagtgcagaccccctggaacccagccacggatgtgtggtggcatgagctgatgcgtggt
gccagcacagagtgtgagcccgagtggtgcgacgccgaggacgagctcttcatcctctac
acgagcggctccactggcaaacccaagggtgtgctgcacaccgtgggtgggtacatgatt
tttgctgccacctcctttaaatacgtgtttgattaccaagctgaggatgtgtactggtgc
acggccgacatcgggtggataacgggccactcctacctcacctacggccccctggccaac
ggggccaccagcgtgctgtttgaaggcgtccccacctacccagatgttggcagaatgtgg
agcatcattgacaagtacaaggtgaccaagttctacacagcacccacggccatccggctg
ctgatgaagtacggcgaggagcctgtcaaaaagcacagcaggaagtccctgaaggtgctg
gggaccgtgggtgagcccatcaaccccgaggcctggctgtggtactaccgtgtggtggga
gaggagaggtgtcccattgtggacaccttctggcagacagagacgggaggccacatgctg
acaccccttcctgctgccacccccatgaagccaggctctgctacattcccctttttcggt
gtggtccctgccatcctgagcgagtcaggggaagagctggaaggagaagcagaaggttac
ctggtgtttaagcagccctggccagggatcatgcgcacgctctacggaaagcaccagcag
tttgaaaccatttacttcaagaagttccctggctactacgtgacaggagatggttgcaga
agagataaagatggttattactggatcacagggcgaattgatgacatgttgaatgtttct
ggccacttgctgagcactgccgaggtggagtcagccctggtggagcacacggcggtggcc
gaggctgctgtggtcagccacccccaccccctgaagggcgagtgcctctactgctttgtg
accctgagagagggccacgagttcaccaagaacctcgcagatgagctcaaaaaacaagtc
agagaaaaaatcgggcccatagcaacacctgattacatccagtacgccccgagcctgccc
aaaacgcgctcaggaaagatcaccagacggatattaaggaagattgccaaaaatgaccaa
gatctgggggacatctccaccttggcagacccgggcatcatcaaacaccttttcagcagc
agatgtgacactaagcagtag

DBGET integrated database retrieval system