KEGG   Taeniopygia guttata (zebra finch): 100224924Help
Entry
100224924         CDS       T01082                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3-like
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100224924
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100224924
   04070 Phosphatidylinositol signaling system
    100224924
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100224924
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100224924
Membrane trafficking [BR:tgu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100224924
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100224924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 658 aa AA seqDB search
LTEDEDVQQMLQGSLLWKVKARGGSRARLFRLQEDGVTVCFEGRFGRARSPRSSPGDRQG
EAGDIPEAGLSPQECDHSGNERLEGRELEEFCRRLLRRPELEELFGHYSGEDQVLSAEEL
QDFLRDQGEESSLRQARAIIRTYELNEKGLTEDEDVQRMLQGSLLWKVKARGGSRARLFR
LQEDGVTVCFEGRFGRARSPRSFSVTQIEGLRQGRQSEGLRQHGAAFPERHCFSLAFKGH
HKNLDLAARAEEDARHWVQGLTKLMGRLQAMSQMEKLDHWIHGVLQRADSNKDNKMSFRE
VKSMLRMLNIDMDDVYASKLFKECDHSGNERLEGRELEEFCRRLLRRPELEELFGRYSGE
DRVLSAEELQDFLRDQGEESSLRQARAIIRTYELNDKAKRQDLMMLDGFTMYLLSAAGDI
LNQEHTEVHQDMSQPLSHYFISSSHNTYLTRHQLGGSSSTEAYVRALRAGCRCVELDCWE
GSDGEPVVYHGHTLTSKILFRDVIESIRDSAFEKSPYPVILSLENHCGLEQQATMARHMK
AILGDRLLTQPLQGQDPHQLPSPEQLKEKILVKGKKLPELWQESQGVTSLLDPEEEEEEE
EEEEEEKDASQVSPELSALVVYCQAVPFPGLARALRHPQPCQVSSFSERKARKLIKEA
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
ggctgacggaggatgaggatgtccagcagatgctgcaggggtccctgctctggaaggtga
aggcccgggggggctccagggcgcggctgttccgcctgcaggaggacggggtcaccgtct
gcttcgagggacgcttcgggcgcgcccgctccccccggagctccccaggggacaggcagg
gcgaggcaggggacatccctgaggccgggctgtccccgcaggagtgtgaccactcgggca
acgagcggctggaggggcgggagctggaggagttctgccggcggctgctgcggcggccgg
agctggaggagctgttcgggcactactcgggcgaggaccaggtcctgtcagccgaggagc
tgcaggatttcctgagggatcagggcgaggagagcagcctgcgccaggcccgcgccatca
tccgcacctacgagctcaacgagaaggggctgacggaggatgaggatgtccagcggatgc
tgcaggggtctctgctctggaaggtgaaggcccgggggggctccagggcgcggctgttcc
gcctgcaggaggacggggtcaccgtctgcttcgagggacgcttcgggcgtgcccgttccc
cccggagcttctcagtgacacagatcgaggggctgcgccagggccggcagtcggaggggc
tgcgccagcacggagccgccttccccgagcgccactgcttcagcctggccttcaagggcc
accacaagaacctggacctggccgcccgcgccgaggaggacgcccggcactgggtgcagg
gcctcaccaagctgatggggcggctgcaggccatgagccagatggagaagctggaccact
ggatccatggggtcctgcagcgagccgacagcaacaaggacaacaagatgtccttccggg
aggtgaagagcatgctgaggatgctcaacatcgacatggacgatgtctacgcctccaagc
tcttcaaggagtgtgaccactcgggcaacgagcggctggaggggcgggagctggaggagt
tctgccggcggctgctgcggcggccggagctggaggagctgttcgggcgctactcgggcg
aggaccgggtcctgtcggccgaggagctgcaggatttcctgagggatcagggcgaggaga
gcagcctgcgccaggcccgcgccatcatccgcacctacgagctcaatgacaaggccaagc
ggcaggatctgatgatgctggacggcttcaccatgtacctgctctcggccgccggtgaca
tcctcaaccaggagcacaccgaggtgcaccaggacatgagccagcccctgagccactact
tcatctcctcctcccacaacacctacctgacccgccaccagctcggcggcagcagcagca
ccgaggcctatgtccgggcgctgcgggcagggtgccgctgcgtggagctggactgctggg
agggctcggacggggagcctgtggtgtaccacggccacacgctcacctccaaaatcctct
tccgcgacgtcatcgagagcatccgcgactctgccttcgagaaatccccctaccccgtca
tcctgtccctggagaaccactgcgggctggagcagcaggccaccatggcccggcacatga
aggccatcctgggggacaggctgctgacacagcccctgcaggggcaggacccccaccagc
tcccctcaccggagcagctgaaggaaaagatcctggtgaagggcaagaagctgccagagc
tgtggcaggagtcacagggtgtcacctccctgctggaccccgaagaggaggaagaggagg
aggaggaagaagaggaggagaaggacgcgtcgcaggtgtccccagagctgtcggcactgg
tggtgtactgccaggctgtccccttccccgggctggcccgggccctgcgccacccccagc
cctgccaggtgtcctccttcagcgagaggaaggcacggaagctcatcaaggaggcag

DBGET integrated database retrieval system