KEGG   Taeniopygia guttata (zebra finch): 100225101Help
Entry
100225101         CDS       T01082                                 

Gene name
MAPK11
Definition
mitogen-activated protein kinase 11
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Salmonella infection
Influenza A
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tgu04010]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:tgu04370]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:tgu04068]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:tgu04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:tgu04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:tgu04622]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:tgu04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:tgu04914]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:tgu04261]
Human Diseases; Infectious diseases; Salmonella infection [PATH:tgu05132]
Human Diseases; Infectious diseases; Influenza A [PATH:tgu05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1A
AA seq 285 aa AA seqDB search
MKHENVIGLLDVFTPATSIENFNEVYLVTNLMGADLNNIVKCQKLTDDHIQFLIYQLLRG
LKYIHSAGIIHRDLKPSNLAVNEDCELRILDFGLARQTDDEMTGYVATRWYRAPEIMLNW
MHYNQTVDIWSVGCIMAELLKGKALFPGNDYIDQLKRIMEVVGTPSSELLKKISSEHARK
YIESLPHMPQQDLKAVFRGANPLAVDLLEKMLILDSDKRITASEALAHPYFVQYHDPDDE
PEAELYDESIENKERTIDEWKELTYEEVNSFKPPDLKMDSLEIEQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatgagaatgttataggactgcttgatgtttttacacctgcaacatcaatagaa
aactttaacgaagtatatcttgtgacaaatttaatgggcgctgacctgaataacattgtg
aagtgccagaagttaacggatgatcatatacagtttctcatctatcagttacttcgaggt
cttaagtatattcactcagctggaatcatccatcgggacctgaagcccagtaacctagct
gtaaatgaagactgtgaattgaggattttagactttggtttagctcgtcaaactgatgat
gaaatgactggatatgttgcaacaagatggtacagagctccagaaattatgttaaactgg
atgcactacaatcaaacagttgacatatggtcggttggatgcatcatggcagagctattg
aagggaaaggctctgtttccaggaaatgattatatcgatcaactgaagagaataatggaa
gttgtgggcacgcccagttcagaacttctgaagaagatatcatctgaacatgcaagaaaa
tacatcgaatctcttccacatatgcctcagcaggatttgaaagcagtgtttcgtggtgcc
aatccattagctgtagatctccttgagaagatgcttattttagacagtgataaaaggatc
actgcatcagaagcacttgcccatccctactttgtacagtaccatgatccggatgatgaa
cctgaggctgagctgtacgacgagtccatagagaacaaggagcgaaccatagatgaatgg
aaagaacttacctatgaagaagtgaatagctttaaaccacccgacttaaaaatggacagc
ctggaaatagaacagtga

DBGET integrated database retrieval system