KEGG   Taeniopygia guttata (zebra finch): 100225128Help
Entry
100225128         CDS       T01082                                 

Gene name
EIF3B
Definition
eukaryotic translation initiation factor 3, subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100225128 (EIF3B)
Translation factors [BR:tgu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100225128 (EIF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 821 aa AA seqDB search
MLFPQFTQELPPSLISQQALAAFGYKFLHPSPSCTLLQLQRQEPVLAPLGAEAQGALREG
PRRLQGPPIQGGRSGRDGSARSGPGPGPGPAGPCQIPALRSDRLRTDTEPCPPLTRSLRA
PLNRFGIKAELPAGAEPGAAQEDGEAAPAAPAEPEDEISFSDPEDFVDDISDEELLGDIL
KDQPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKIINEFYPEADGKTKGYI
FLEYMSPSHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWEIPEKQPFKDLGNL
RYWLEDPDCRDQYSVIFESGDRTSIFWNDIKEPVQIEDRARWTETYVRWSPKGTYLATFH
QRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGQ
KKRGFHCENSAHWPIFKWSHDGKFFARMTSDTLSIYETPSMGLLDKKSLKINGIRDFSWS
PGGNIIAFWVPEDKDIPARVTLMQLPSRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRT
PKGTQGVVTNFEIFRMREKQVPVDVVEMKESIIAFAWEPNGSKFAVLHGETPRISVSFYH
VKNNGKIELIKTFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTMMNIAEHYT
ASDVEWDPTGRYIVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPATLLS
EDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEEFRKYRKMAQELYMEQRN
ERLELRGGVDTDELDSNVDDWEEETVEFFINEEIITLAEPE
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgttattccctcagttcacccaggagctccctccatctctcatttcgcaacaagcgctg
gcagcattcggctacaagtttctccatcccagccccagctgcacgctgctccaactccag
cgccaggagccggtgcttgcgccgctgggagcggaggcacagggagcgctgcgagagggt
ccgcgccggctccaaggtcctcctatccaaggcgggcgctccgggcgcgacggctccgcc
cggtccggtcccggtcccggtcccggccccgcggggccgtgtcaaatcccagcgctgcgc
tcggaccggctccgcacggacaccgagccgtgcccgccgctgaccagatcgctgcgagcg
cctctgaaccgcttcgggattaaggccgagctcccggccggggccgagcccggcgcggcg
caggaggacggggaggccgcgcccgcagccccggccgagcccgaggatgagatttccttc
agcgaccccgaggacttcgtggacgacatcagcgacgaagaactgcttggtgacatcctg
aaagatcagccacaggaggcagatggaatagactcagtgattgttgtggataatgtgccc
caggttggaccagaccgactggagaaactgaagaatgtcatccacaaaatattttccaag
tttggtaaaattatcaatgaattttatccagaagcagatggaaaaacaaaagggtacatc
ttcctggagtacatgtctccctcccacgccgtggacgctgtgaagaatgcagatggatac
aaactggacaagcagcacacattcagagtcaacctcttcacagactttgataagtacatg
acaatcagtgacgagtgggaaatccctgagaaacagccatttaaggatttggggaatctc
cggtactggttggaagaccctgattgcagggatcagtacagcgtgatctttgagtcagga
gaccggacttccattttttggaatgacatcaaggaacctgttcaaattgaggacagagca
aggtggacagagacttacgtccgttggtcccccaaaggcacctacctggctaccttccac
cagaggggcattgctctgtggggtggagagaagttcaagcagattcaaaggttcagtcac
caaggagtgcagctcattgacttctcaccctgtgaaaggtatctagtgaccttcagtcct
ttgatggacacacaggatgaccctcaggctatcatcatctgggatattctgactggccaa
aagaagagaggattccactgtgaaaactcagctcactggcctatttttaaatggagtcat
gatggtaaattctttgctcgaatgacttcagataccctcagcatctatgaaacaccttct
atgggtttgttggacaaaaagagcttgaaaatcaatgggataagagacttctcatggtct
ccaggtggtaacataattgctttctgggtgcctgaggacaaagacatcccagcaagagtg
actttgatgcagctgccttctagacaagaaattcgtgtgcggaatttgttcaacgtagta
gattgtaaactgcactggcagaagaacggggactacctgtgtgtgaaggtagacaggact
cccaaaggcacacagggagtagtgaccaactttgaaatattccgcatgagagagaaacag
gtgccggtggatgtggtggaaatgaaagaaagcatcatagcctttgcttgggaaccaaat
ggaagcaagtttgctgtgttgcatggagaaactccacgaatttcagtgtccttttaccat
gttaaaaacaacgggaaaatagaactcataaagacttttgacaaacagcaggcaaacacg
atattctggagtccccaggggcagtttgtggtgttggctggcctcagaagcatgaatggt
gccttagcatttgttgacacgtcggactgcaccatgatgaacatcgcggagcactacacg
gcctcggatgtggagtgggaccccacgggcagatacattgtcacctctgtgtcttggtgg
agccacaaggtggacaatgcatattggttatggaccttccaaggccgtctgcttcagaaa
aacaacaaagacaggttctgtcagctgctctggagaccacgaccagctaccctgctcagt
gaggatcagataaagcaaattaagaaagacctgaagaaatactccaagatatttgagcag
aaggatcgcctgagccagtccaaagcttcaaaggagctggtggagcggcggcgcacgatg
atggaggagttcaggaagtaccgcaagatggcacaagagctgtacatggagcagcgcaac
gagcgcctggagctgcgcgggggggtagacacagatgagctggacagcaatgtcgatgac
tgggaggaggagactgtggaattttttatcaatgaagaaattattacccttgcagaacca
gagtaa

DBGET integrated database retrieval system