KEGG   Taeniopygia guttata (zebra finch): 100225257Help
Entry
100225257         CDS       T01082                                 

Definition
acetyl-CoA carboxylase-like
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tgu01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tgu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tgu00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:tgu00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:tgu04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 2332 aa AA seqDB search
MEESSGASKGADAPSRFIIGSVSEDNSEDETSSLVKLDLLEEKERSLSPASVCSDSLSDL
GLPSAQEGPASHMRPSMSGLHLVKQGRDRKKVDVQRDFTVASPAEFVTRFGGNKVIEKVL
IANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGP
NNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLHKNGIAFMGPPSQAMWALGD
KIASSIVAQTAGIPTLPWSGSGLRVDWQENDLQKRILSVPPELYEKGYVRDADDGLRAAE
EVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQTEVPGSPIFVMRLAKQSRHLEVQI
LADQYGNAISLFGRDCSVQRRHQKIIEEAPASIATSTVFEHMEQCAVKLAKMVGYVSAGT
VEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLHRIKDIRVMYGV
SPWGDTTIDFENSAHVPSPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFS
VAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETES
FQQNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSFRNSVSNFLHSLERGQVLP
AHTLLNTVDVELIYEGRKYVLKVTRQSPNSYVVIMNSSCVEVDVHRLSDGGLLLSYDGSS
YTTYMKEEVDRYRITIGNKTCVFEKENDPSILRSPSAGKLIQYVVEDGGHVFAGQCFAEI
EVMKMVMTITAGESGCIHYVKRPGAVLDPGCVIAKLQLDDPSRVQQAELHTGTLPQIQST
ALRGEKLHRIFHYVLDNLVNVMNGYCLPEPFFSSKVKGWVERLMKTLRDPSLPLLELQDI
MTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFF
MNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLKVETQFQHGHYDKCVFTLREENKSDMN
AVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELINILTELTQLSKTTNAKVALRAR
QVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSN
QVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRMSFSSNLNHYG
MAHVASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFCDSPPQSPTFPEAG
HASLYDEDKSAREEPIHILNVAIKTDGDVDDDGLAAMFREFTQSKKSVLIEHGIRRLTFL
VAQKREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYL
GAAKVEVGTEVNRLQVLSSRAIDYRFFFRAFIXXXXXXXQEASFEYLQNEGERLLLEAMD
ELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAELKI
NIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGDKQGPLHGMLINT
PYVTKDLLPPPGFQAQTLGTSYVYDIHEMFRQSLIKLWNSMNEHAFLPPTPLPSDILTYT
ELVLDDQGQLVHMNRLPGGNEIGMVAWKMTLKTPEYPEGRDIIVIGNDITYKIGSFGPQE
DVLFLRASELARAQGIPRIYVAANSGARIGLAEEIRHMFHVAWEDPDNPYKGYKYLYLTP
QDYKKVSALNSVHCEHVEENGESRYKITDIIGKEDGLGVENLRASGMIAGESSLAYDSVI
TISLVTCRAIGIGAYIVRLGQRTIQVENSHIILTSCGALLPVLGREVYTSNNQLGGIQIM
HNNGVTHDTVCDDFEGVYTILQWLSYMPKNIHSPVPMLKAKDPIDRTIDFVPTKAPYDPR
WMLAGRPNPNQKGQWLSGFFDHGSFMEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVEL
SIPADPANLDSEAKIIQQAGQVWFPDSAFKTAEAIKDFNREGLPLMVFANWRGFSGGMKD
MYDQVLKFGAYIVDGLREYRQPVLIYIPPQGELRGGSWVVIDPTINPRHMEMYADRDSRG
GILEPEGTVEIRFRRKDLVKTMRRVDPVYIQLAERLGTPELSPADRKELEAKLKEREEFL
APMYQQVAIQFADLHDTPGRMQEKGAITDVLDWKTSRTFFYWRLRRLLLEEAVKGKIHEA
NPELTDGQIQAMLRRWFVEVEGTVKAYLWDSNKDLVEWLEKQLTEEEGVRSVVEENIKYI
SRDYVLKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDSPSST
NT seq 6999 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatcttccggagccagcaaaggcgcggacgctccctcgcgcttcatcatcggc
tccgtgtccgaggacaactcggaggatgagaccagctccttggtgaagctggatctgctg
gaggagaaggagaggtctttgtcccctgcgtccgtctgctccgattccctctcggacctg
gggcttcccagtgctcaggaaggcccggccagccacatgaggcccagcatgtcgggtttg
caccttgtcaagcaaggccgggacaggaagaaggtggatgtgcagcgagatttcaccgtg
gcctctccagcagagtttgttactcgttttggaggcaataaagttattgaaaaggtcctg
atagcaaataatggcattgcagcagtgaagtgcatgaggtccatccggcgctggtcctac
gagatgttcaggaacgagagggccatcaggttcgtggtcatggtcacccctgaggacctg
aaagccaacgcagagtacattaaaatggcagatcactacgtgcccgtcccgggaggaccc
aacaacaacaactatgcaaacgtggagctcatcctggacatcgccaagaggatcccagtg
caggctgtgtgggctggctggggccatgcatcagagaaccccaaactgccagaacttctc
cacaaaaacgggattgctttcatgggtcctcccagccaagccatgtgggccttgggagat
aaaattgcttcttccatcgttgctcagactgctggcattccaactcttccttggagtggc
agtggcctccgagtggactggcaggagaacgacctccagaagcgcatcctgagcgtccct
ccggagctctacgagaagggctacgtgcgggacgccgacgacggactgcgggctgctgag
gaggttggctaccctgtcatgatcaaggcttctgaaggaggaggaggaaaaggaatcagg
aaagtgaacaatgcagatgacttccccaatctgttcagacaggttcaaactgaagtccca
ggctctcccatcttcgtgatgaggctggccaaacagtccaggcacctggaggtgcagatc
ctggcggaccagtacggcaacgccatctccctcttcggccgcgactgctccgtgcagcgc
cggcaccagaagatcatcgaggaggctccagcctccattgcaacctcaacggtgtttgag
cacatggagcagtgcgcagtgaagctggccaaaatggtggggtacgtcagtgcaggcact
gtggagtacctgtacagccaggacggcagcttctacttcctggagctgaacccacgcctg
caggtggaacatccctgcactgagatggtggcagacgtcaacctgcccgcagcacagctc
cagattgccatggggatccccctgcacaggatcaaggatatcagggtgatgtatggggtt
tctccctggggagacacaaccattgattttgagaactcagcccacgtccccagcccccgt
ggccatgtcatcgctgcccggatcaccagtgagaatcctgatgaggggtttaagcccagt
tctggcacagttcaggagctgaatttccgcagcaataagaatgtctggggctatttcagt
gtggctgctgcaggggggctccatgaatttgctgattcccagtttggtcactgcttctcc
tggggagagaaccgtgaagaagccatctcaaacatggtggtggctctgaaggagctgtcc
atccgaggggacttcaggaccactgtggaatacttgatcaagctgctggagacggagagc
ttccagcagaaccgcatcgacacgggctggctggaccggctcatcgctgagaaagtgcag
gctgagaggcctgacaccatgctgggggtggtgtgtggggctctgcacgtggctgacgtg
agcttccgaaacagcgtctccaacttcctgcactccctggaaaggggccaagtcctgcct
gctcacactctgctcaacacggtggacgtggagctgatctacgagggacggaagtacgtg
ctgaaggtgaccaggcagtctcccaattcctacgtggtgatcatgaacagctcctgcgtg
gaagtcgacgtgcatcgcctgagtgacggggggctgctcctctcctacgatggcagcagc
tacaccacctacatgaaagaagaagtggacaggtatcgcatcaccattgggaacaagacc
tgtgtgtttgagaaggagaatgatccctccatcctgcgctcgccctccgctgggaagctg
atccagtatgtggtggaggatgggggacacgtgtttgcaggccagtgctttgcagaaatt
gaggtgatgaaaatggtgatgacgataacagcaggagaatcaggctgcatccactatgtc
aagcgcccaggggcagtcctggatccaggctgtgtgattgccaagctgcagctggatgat
cccagcagggttcagcaggctgagctgcacacgggtaccctgccccagatccagagcaca
gcgctgcggggcgagaagctccatcgcatcttccactacgtgctggacaacctggtcaac
gtgatgaatgggtactgcctgccagagcccttcttcagcagcaaggtgaagggctgggtt
gagcgattaatgaagaccctgagggatccatctttgcccctgctggagcttcaggacatc
atgaccagtgtttctgggcggataccacccaatgtagagaagtccatcaagaaggagatg
gcccagtatgccagcaacatcacctcggtcctctgccagtttcccagccagcagattgcc
aacatcctggacagccacgcggccaccctgaaccgcaagtcggagcgcgaggttttcttc
atgaacacccagagcatcgtgcagctcgtgcagaggtaccgcagtggcattcggggccac
atgaaggccgtggtgatggatctgctccggcagtacctgaaggtggagactcagttccag
cacggtcactatgacaagtgtgtcttcacccttcgtgaggagaacaagagtgacatgaac
gcagtgctgaactacatcttctcccacgcccaggtcaccaagaagaacctgctggttaca
atgctcattgaccagctctgtggccgtgaccccaccttgacagacgagctgatcaatatc
ctgacggagctgacccagctcagcaagacgaccaacgccaaggtggccctgcgagcgcgg
caggttctcattgcttcccacctgccctcctacgagctgcgtcacaaccaggtggagtcc
atcttcctgtcggccatcgacatgtacggccaccagttctgcattgagaacctgcagaaa
ctcattttgtctgagacatccatctttgatgtgcttcccaacttcttctaccacagtaac
caggtggtgagaatggcagctttggaggtgtacgtgaggagagcctacattgcctacgag
ctgaacagcgtgcagcaccgccagctgaaggacaacacctgcgtggtggagttccagttc
atgctgcccacctcccaccccaacaggatgtccttctcctccaacctcaaccactacggg
atggcacacgtggccagcgtgagcgacgtgctgctggacaactccttcacgccgccgtgc
cagcgcatgggcgggatggtctccttccgcaccttcgaggactttgtcaggatctttgat
gaagtcatgggatgcttctgcgactctcccccgcagagcccgacgttccccgaggccggc
cacgcttccctctatgatgaagacaagagtgcccgggaggagcccatccacatcctcaac
gtggccatcaaaaccgacggcgacgtggacgacgacggcctggctgccatgttcagggag
ttcacccagagcaagaaatcagtcctgattgagcatggcattcggaggctgactttcctt
gtagcacaaaagagggaattcccaaagttcttcaccttccgtgcccgggataagttcgag
gaggacaggatttaccggcacctggagccagccctggccttccagctggagctgaaccgc
atgaggaacttcgacctcacggccatcccctgtgccaaccacaagatgcacctctacctg
ggggctgccaaggtggaggtgggcactgaagtgaacagactacaggttctttcgtcaagg
gccatagactacaggttcttcttcagggcattcatannnnnnnnnnnnnnnnnnnnncag
gaagcctcctttgagtacctgcaaaacgagggcgagcgtttgctgctggaggccatggat
gagctggaggtggccttcaacaacaccaacgtgcgcacggactgcaaccacatcttcctc
aacttcgtgcccaccgtcatcatggacccctccaagatcgaggagtcggtgcgctccatg
gtgatgcgctacggcagccgcctctggaagctgcgcgtgctgcaggccgagctgaagatc
aacatccgcctgacgcccacggggaaggccatccccatccgcctcttcctcaccaacgag
tcgggctactacctggacatcagcctctacaaggaggtgacggactccaggacggcacag
atcatgttccaggcgtatggagacaagcagggaccgctccatgggatgctgatcaacact
ccctacgtgaccaaagacctgctgccccccccggggttccaggcacagactttagggaca
tcctatgtctatgacattcatgagatgttcaggcagtcgctgatcaagctgtggaactcc
atgaacgagcacgccttcctgccaccaacgccgctgccctcggacatcctgacctacacg
gagctggtgctggatgaccagggccagctggtgcacatgaacaggctgccaggaggaaat
gagatcggcatggtggcctggaagatgacgctgaagacgccggagtacccggagggccgg
gatatcattgtcattggcaatgacatcacctacaaaatcggctcctttgggccccaggag
gatgtgctgttcctcagggcctccgagctggcccgggctcagggcattccccggatttac
gtggctgccaacagcggggccaggatcggcctggccgaggagatccgccacatgttccac
gtggcttgggaagacccagacaacccctacaagggatacaaatacctgtacctgactcct
caagactacaagaaagtcagtgccctgaactctgttcactgtgaacacgtggaggaaaat
ggagagtccaggtacaagataacagatattatcgggaaggaggacgggcttggagtagag
aacctcagagcatctggcatgattgctggagaatcatctttagcctatgatagtgttatc
accatcagcttggtcacgtgtcgggcaattgggattggggcttacatcgtccggctgggc
cagagaaccatccaggtggagaactcccacatcatcctcaccagctgtggagccctgctc
cctgtgcttggacgggaagtttacacctccaacaaccagctgggagggatccagatcatg
cacaacaacggggtgacacatgacaccgtctgtgatgactttgaaggagtctacaccatt
ctgcagtggctttcctacatgccaaagaacatacacagccctgtgcccatgctgaaagcc
aaggaccccatagacagaaccattgactttgttcccaccaaggccccctacgaccctcgc
tggatgctggctggacgccccaacccaaatcagaaagggcagtggctgagtgggttcttc
gaccacggctcgttcatggagatcatgcagccctgggcacagacagtcgtggtggggaga
gccaggctgggaggaatacctgtaggggtggttgctgtggaaacaaggacggtggagctc
agcattcctgctgatcctgcaaacctggactcggaggccaagataatccagcaggctggg
caggtgtggttccctgactctgccttcaaaacagccgaggcaatcaaggacttcaacagg
gaagggttgcccctgatggtctttgccaactggagaggcttctctgggggaatgaaagac
atgtatgaccaggtgctgaagtttggggcctacatcgtggacgggctgcgggagtaccgg
cagccggtgctgatctacatcccgccgcagggcgagctgcgcggcggctcctgggtggtc
atcgaccccaccatcaacccccggcacatggagatgtacgccgacagggacagcagagga
gggatcctggagcccgaggggacggtggagatccgcttccgcaggaaggacctggtgaag
acgatgcgcagggtggacccggtgtacatccagctggccgagcgcctgggcacccccgag
ctgagcccggcggacaggaaggagctggaggccaagctgaaggagcgggaggagttcctg
gcccccatgtaccagcaggtggccattcagttcgctgacctgcacgacacgcccggcagg
atgcaggagaagggcgccatcaccgacgtgctggactggaaaacctcgcgcaccttcttc
tactggcggctgcggcggctgctgctggaggaggccgtgaagggcaagatccacgaggcc
aaccccgagctgacggacgggcagatccaggccatgctgcgccgctggttcgtcgaggtg
gagggcacggtcaaggcctacctgtgggacagcaacaaggacctggtggagtggctggag
aagcagctgacggaggaggagggcgttcgctcggtggtggaggagaacatcaagtacatc
tccagggattacgtgctcaagcagatccggagcctggtccaggccaaccccgaggttgcc
atggattccatcgtgcacatgacccagcacatctcccccacgcagcgagccgaggtcgtg
cggatcctctccacaatggactcgccttcgtccacgtag

DBGET integrated database retrieval system