KEGG   Taeniopygia guttata (zebra finch): 100225257Help
Entry
100225257         CDS       T01082                                 

Definition
acetyl-CoA carboxylase-like
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100225257
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100225257
   00640 Propanoate metabolism
    100225257
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100225257
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100225257
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100225257
Enzymes [BR:tgu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100225257
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100225257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 2332 aa AA seqDB search
MEESSGASKGADAPSRFIIGSVSEDNSEDETSSLVKLDLLEEKERSLSPASVCSDSLSDL
GLPSAQEGPASHMRPSMSGLHLVKQGRDRKKVDVQRDFTVASPAEFVTRFGGNKVIEKVL
IANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGP
NNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLHKNGIAFMGPPSQAMWALGD
KIASSIVAQTAGIPTLPWSGSGLRVDWQENDLQKRILSVPPELYEKGYVRDADDGLRAAE
EVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQTEVPGSPIFVMRLAKQSRHLEVQI
LADQYGNAISLFGRDCSVQRRHQKIIEEAPASIATSTVFEHMEQCAVKLAKMVGYVSAGT
VEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLHRIKDIRVMYGV
SPWGDTTIDFENSAHVPSPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFS
VAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETES
FQQNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSFRNSVSNFLHSLERGQVLP
AHTLLNTVDVELIYEGRKYVLKVTRQSPNSYVVIMNSSCVEVDVHRLSDGGLLLSYDGSS
YTTYMKEEVDRYRITIGNKTCVFEKENDPSILRSPSAGKLIQYVVEDGGHVFAGQCFAEI
EVMKMVMTITAGESGCIHYVKRPGAVLDPGCVIAKLQLDDPSRVQQAELHTGTLPQIQST
ALRGEKLHRIFHYVLDNLVNVMNGYCLPEPFFSSKVKGWVERLMKTLRDPSLPLLELQDI
MTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFF
MNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLKVETQFQHGHYDKCVFTLREENKSDMN
AVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELINILTELTQLSKTTNAKVALRAR
QVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSN
QVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRMSFSSNLNHYG
MAHVASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFCDSPPQSPTFPEAG
HASLYDEDKSAREEPIHILNVAIKTDGDVDDDGLAAMFREFTQSKKSVLIEHGIRRLTFL
VAQKREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYL
GAAKVEVGTEVNRLQVLSSRAIDYRFFFRAFIXXXXXXXQEASFEYLQNEGERLLLEAMD
ELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAELKI
NIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGDKQGPLHGMLINT
PYVTKDLLPPPGFQAQTLGTSYVYDIHEMFRQSLIKLWNSMNEHAFLPPTPLPSDILTYT
ELVLDDQGQLVHMNRLPGGNEIGMVAWKMTLKTPEYPEGRDIIVIGNDITYKIGSFGPQE
DVLFLRASELARAQGIPRIYVAANSGARIGLAEEIRHMFHVAWEDPDNPYKGYKYLYLTP
QDYKKVSALNSVHCEHVEENGESRYKITDIIGKEDGLGVENLRASGMIAGESSLAYDSVI
TISLVTCRAIGIGAYIVRLGQRTIQVENSHIILTSCGALLPVLGREVYTSNNQLGGIQIM
HNNGVTHDTVCDDFEGVYTILQWLSYMPKNIHSPVPMLKAKDPIDRTIDFVPTKAPYDPR
WMLAGRPNPNQKGQWLSGFFDHGSFMEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVEL
SIPADPANLDSEAKIIQQAGQVWFPDSAFKTAEAIKDFNREGLPLMVFANWRGFSGGMKD
MYDQVLKFGAYIVDGLREYRQPVLIYIPPQGELRGGSWVVIDPTINPRHMEMYADRDSRG
GILEPEGTVEIRFRRKDLVKTMRRVDPVYIQLAERLGTPELSPADRKELEAKLKEREEFL
APMYQQVAIQFADLHDTPGRMQEKGAITDVLDWKTSRTFFYWRLRRLLLEEAVKGKIHEA
NPELTDGQIQAMLRRWFVEVEGTVKAYLWDSNKDLVEWLEKQLTEEEGVRSVVEENIKYI
SRDYVLKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDSPSST
NT seq 6999 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatcttccggagccagcaaaggcgcggacgctccctcgcgcttcatcatcggc
tccgtgtccgaggacaactcggaggatgagaccagctccttggtgaagctggatctgctg
gaggagaaggagaggtctttgtcccctgcgtccgtctgctccgattccctctcggacctg
gggcttcccagtgctcaggaaggcccggccagccacatgaggcccagcatgtcgggtttg
caccttgtcaagcaaggccgggacaggaagaaggtggatgtgcagcgagatttcaccgtg
gcctctccagcagagtttgttactcgttttggaggcaataaagttattgaaaaggtcctg
atagcaaataatggcattgcagcagtgaagtgcatgaggtccatccggcgctggtcctac
gagatgttcaggaacgagagggccatcaggttcgtggtcatggtcacccctgaggacctg
aaagccaacgcagagtacattaaaatggcagatcactacgtgcccgtcccgggaggaccc
aacaacaacaactatgcaaacgtggagctcatcctggacatcgccaagaggatcccagtg
caggctgtgtgggctggctggggccatgcatcagagaaccccaaactgccagaacttctc
cacaaaaacgggattgctttcatgggtcctcccagccaagccatgtgggccttgggagat
aaaattgcttcttccatcgttgctcagactgctggcattccaactcttccttggagtggc
agtggcctccgagtggactggcaggagaacgacctccagaagcgcatcctgagcgtccct
ccggagctctacgagaagggctacgtgcgggacgccgacgacggactgcgggctgctgag
gaggttggctaccctgtcatgatcaaggcttctgaaggaggaggaggaaaaggaatcagg
aaagtgaacaatgcagatgacttccccaatctgttcagacaggttcaaactgaagtccca
ggctctcccatcttcgtgatgaggctggccaaacagtccaggcacctggaggtgcagatc
ctggcggaccagtacggcaacgccatctccctcttcggccgcgactgctccgtgcagcgc
cggcaccagaagatcatcgaggaggctccagcctccattgcaacctcaacggtgtttgag
cacatggagcagtgcgcagtgaagctggccaaaatggtggggtacgtcagtgcaggcact
gtggagtacctgtacagccaggacggcagcttctacttcctggagctgaacccacgcctg
caggtggaacatccctgcactgagatggtggcagacgtcaacctgcccgcagcacagctc
cagattgccatggggatccccctgcacaggatcaaggatatcagggtgatgtatggggtt
tctccctggggagacacaaccattgattttgagaactcagcccacgtccccagcccccgt
ggccatgtcatcgctgcccggatcaccagtgagaatcctgatgaggggtttaagcccagt
tctggcacagttcaggagctgaatttccgcagcaataagaatgtctggggctatttcagt
gtggctgctgcaggggggctccatgaatttgctgattcccagtttggtcactgcttctcc
tggggagagaaccgtgaagaagccatctcaaacatggtggtggctctgaaggagctgtcc
atccgaggggacttcaggaccactgtggaatacttgatcaagctgctggagacggagagc
ttccagcagaaccgcatcgacacgggctggctggaccggctcatcgctgagaaagtgcag
gctgagaggcctgacaccatgctgggggtggtgtgtggggctctgcacgtggctgacgtg
agcttccgaaacagcgtctccaacttcctgcactccctggaaaggggccaagtcctgcct
gctcacactctgctcaacacggtggacgtggagctgatctacgagggacggaagtacgtg
ctgaaggtgaccaggcagtctcccaattcctacgtggtgatcatgaacagctcctgcgtg
gaagtcgacgtgcatcgcctgagtgacggggggctgctcctctcctacgatggcagcagc
tacaccacctacatgaaagaagaagtggacaggtatcgcatcaccattgggaacaagacc
tgtgtgtttgagaaggagaatgatccctccatcctgcgctcgccctccgctgggaagctg
atccagtatgtggtggaggatgggggacacgtgtttgcaggccagtgctttgcagaaatt
gaggtgatgaaaatggtgatgacgataacagcaggagaatcaggctgcatccactatgtc
aagcgcccaggggcagtcctggatccaggctgtgtgattgccaagctgcagctggatgat
cccagcagggttcagcaggctgagctgcacacgggtaccctgccccagatccagagcaca
gcgctgcggggcgagaagctccatcgcatcttccactacgtgctggacaacctggtcaac
gtgatgaatgggtactgcctgccagagcccttcttcagcagcaaggtgaagggctgggtt
gagcgattaatgaagaccctgagggatccatctttgcccctgctggagcttcaggacatc
atgaccagtgtttctgggcggataccacccaatgtagagaagtccatcaagaaggagatg
gcccagtatgccagcaacatcacctcggtcctctgccagtttcccagccagcagattgcc
aacatcctggacagccacgcggccaccctgaaccgcaagtcggagcgcgaggttttcttc
atgaacacccagagcatcgtgcagctcgtgcagaggtaccgcagtggcattcggggccac
atgaaggccgtggtgatggatctgctccggcagtacctgaaggtggagactcagttccag
cacggtcactatgacaagtgtgtcttcacccttcgtgaggagaacaagagtgacatgaac
gcagtgctgaactacatcttctcccacgcccaggtcaccaagaagaacctgctggttaca
atgctcattgaccagctctgtggccgtgaccccaccttgacagacgagctgatcaatatc
ctgacggagctgacccagctcagcaagacgaccaacgccaaggtggccctgcgagcgcgg
caggttctcattgcttcccacctgccctcctacgagctgcgtcacaaccaggtggagtcc
atcttcctgtcggccatcgacatgtacggccaccagttctgcattgagaacctgcagaaa
ctcattttgtctgagacatccatctttgatgtgcttcccaacttcttctaccacagtaac
caggtggtgagaatggcagctttggaggtgtacgtgaggagagcctacattgcctacgag
ctgaacagcgtgcagcaccgccagctgaaggacaacacctgcgtggtggagttccagttc
atgctgcccacctcccaccccaacaggatgtccttctcctccaacctcaaccactacggg
atggcacacgtggccagcgtgagcgacgtgctgctggacaactccttcacgccgccgtgc
cagcgcatgggcgggatggtctccttccgcaccttcgaggactttgtcaggatctttgat
gaagtcatgggatgcttctgcgactctcccccgcagagcccgacgttccccgaggccggc
cacgcttccctctatgatgaagacaagagtgcccgggaggagcccatccacatcctcaac
gtggccatcaaaaccgacggcgacgtggacgacgacggcctggctgccatgttcagggag
ttcacccagagcaagaaatcagtcctgattgagcatggcattcggaggctgactttcctt
gtagcacaaaagagggaattcccaaagttcttcaccttccgtgcccgggataagttcgag
gaggacaggatttaccggcacctggagccagccctggccttccagctggagctgaaccgc
atgaggaacttcgacctcacggccatcccctgtgccaaccacaagatgcacctctacctg
ggggctgccaaggtggaggtgggcactgaagtgaacagactacaggttctttcgtcaagg
gccatagactacaggttcttcttcagggcattcatannnnnnnnnnnnnnnnnnnnncag
gaagcctcctttgagtacctgcaaaacgagggcgagcgtttgctgctggaggccatggat
gagctggaggtggccttcaacaacaccaacgtgcgcacggactgcaaccacatcttcctc
aacttcgtgcccaccgtcatcatggacccctccaagatcgaggagtcggtgcgctccatg
gtgatgcgctacggcagccgcctctggaagctgcgcgtgctgcaggccgagctgaagatc
aacatccgcctgacgcccacggggaaggccatccccatccgcctcttcctcaccaacgag
tcgggctactacctggacatcagcctctacaaggaggtgacggactccaggacggcacag
atcatgttccaggcgtatggagacaagcagggaccgctccatgggatgctgatcaacact
ccctacgtgaccaaagacctgctgccccccccggggttccaggcacagactttagggaca
tcctatgtctatgacattcatgagatgttcaggcagtcgctgatcaagctgtggaactcc
atgaacgagcacgccttcctgccaccaacgccgctgccctcggacatcctgacctacacg
gagctggtgctggatgaccagggccagctggtgcacatgaacaggctgccaggaggaaat
gagatcggcatggtggcctggaagatgacgctgaagacgccggagtacccggagggccgg
gatatcattgtcattggcaatgacatcacctacaaaatcggctcctttgggccccaggag
gatgtgctgttcctcagggcctccgagctggcccgggctcagggcattccccggatttac
gtggctgccaacagcggggccaggatcggcctggccgaggagatccgccacatgttccac
gtggcttgggaagacccagacaacccctacaagggatacaaatacctgtacctgactcct
caagactacaagaaagtcagtgccctgaactctgttcactgtgaacacgtggaggaaaat
ggagagtccaggtacaagataacagatattatcgggaaggaggacgggcttggagtagag
aacctcagagcatctggcatgattgctggagaatcatctttagcctatgatagtgttatc
accatcagcttggtcacgtgtcgggcaattgggattggggcttacatcgtccggctgggc
cagagaaccatccaggtggagaactcccacatcatcctcaccagctgtggagccctgctc
cctgtgcttggacgggaagtttacacctccaacaaccagctgggagggatccagatcatg
cacaacaacggggtgacacatgacaccgtctgtgatgactttgaaggagtctacaccatt
ctgcagtggctttcctacatgccaaagaacatacacagccctgtgcccatgctgaaagcc
aaggaccccatagacagaaccattgactttgttcccaccaaggccccctacgaccctcgc
tggatgctggctggacgccccaacccaaatcagaaagggcagtggctgagtgggttcttc
gaccacggctcgttcatggagatcatgcagccctgggcacagacagtcgtggtggggaga
gccaggctgggaggaatacctgtaggggtggttgctgtggaaacaaggacggtggagctc
agcattcctgctgatcctgcaaacctggactcggaggccaagataatccagcaggctggg
caggtgtggttccctgactctgccttcaaaacagccgaggcaatcaaggacttcaacagg
gaagggttgcccctgatggtctttgccaactggagaggcttctctgggggaatgaaagac
atgtatgaccaggtgctgaagtttggggcctacatcgtggacgggctgcgggagtaccgg
cagccggtgctgatctacatcccgccgcagggcgagctgcgcggcggctcctgggtggtc
atcgaccccaccatcaacccccggcacatggagatgtacgccgacagggacagcagagga
gggatcctggagcccgaggggacggtggagatccgcttccgcaggaaggacctggtgaag
acgatgcgcagggtggacccggtgtacatccagctggccgagcgcctgggcacccccgag
ctgagcccggcggacaggaaggagctggaggccaagctgaaggagcgggaggagttcctg
gcccccatgtaccagcaggtggccattcagttcgctgacctgcacgacacgcccggcagg
atgcaggagaagggcgccatcaccgacgtgctggactggaaaacctcgcgcaccttcttc
tactggcggctgcggcggctgctgctggaggaggccgtgaagggcaagatccacgaggcc
aaccccgagctgacggacgggcagatccaggccatgctgcgccgctggttcgtcgaggtg
gagggcacggtcaaggcctacctgtgggacagcaacaaggacctggtggagtggctggag
aagcagctgacggaggaggagggcgttcgctcggtggtggaggagaacatcaagtacatc
tccagggattacgtgctcaagcagatccggagcctggtccaggccaaccccgaggttgcc
atggattccatcgtgcacatgacccagcacatctcccccacgcagcgagccgaggtcgtg
cggatcctctccacaatggactcgccttcgtccacgtag

DBGET integrated database retrieval system