KEGG   Taeniopygia guttata (zebra finch): 100225383Help
Entry
100225383         CDS       T01082                                 

Definition
fatty acyl-CoA hydrolase precursor, medium chain-like
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100225383
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100225383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 556 aa AA seqDB search
MAAARDTALLACVLFLGGTALGAAGKHRGEPEAETKYGRVRGYPFTVDTAERTVNVFLGL
PFAKPPLGSLRFSEPQPPEPWEGVRDATSYPPMCLQDQVQGQNISDMITNRKEKVPLRVS
EDCLYLNVYTPVSTGKQEKLPVLVWIHGGGLLVGAASSYDGSAIAAFDNVVVVTIQYRLG
IAGYFSTGDEHARGNWGYLDQVAALRWIQENIMHFGGDPGSVTIFGESAGGISVSALVLS
PLAKGLFHKAISESGTVTLGLFTDQPKEDAQKIAAASGCEKSSSAAMVECLRGKTEEELL
QITLKMDFFLINTCVDGAFFPKSPKELLSEKSMNEVPYIIGVNNCEFGWVIPMAMKYPFV
DGLEKDVARQILKSNLAKLNKGLTSEVVDRVYKEYMGHAESPAQVRDGLLDAMGDVYFVI
SAVEVARYHRDAGNPVYFYEFQHRPSSMEGVVPEFVKADHGAEIAFVFGKPFLAGGATKE
EDKLSRTVMRYWTNFAKNGNPNGEGLVHWPLYDLEEKYLGIDLEQKAAEKLKEHRMQFWQ
QLMKQSQTGRTKHTDL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgcgagggacacggcgctgctggcctgcgtcctcttcctcgggggcacggcg
ctgggggccgcaggtaaacaccggggagaaccagaagcggagaccaaatatgggagagtc
cgaggctacccattcacagtggacacagctgagaggactgtaaatgtctttttgggactt
ccttttgctaagcctccgcttggatccctgaggttttctgaaccccagccaccggagcct
tgggaaggtgtcagagatgccacttcctacccaccaatgtgtctacaagaccaagtacaa
ggacagaatatttcagatatgattaccaacagaaaagagaaagttcctctgcgagtgtct
gaggattgcctgtacctaaatgtgtacacacccgtttctacaggaaaacaggagaagctg
cctgtcttagtatggatccatggaggtggattacttgttggagcagcttcatcatatgat
ggctcagcaatagcagcctttgacaacgtggtggttgtaacaattcagtacagactaggt
attgctggatattttagcactggtgatgagcatgcccgaggtaactggggatatttagac
caagtagcagctcttcggtggattcaggaaaatatcatgcattttggtggagatccagga
tctgtcaccatctttggagaatctgcaggaggaatcagtgtttctgctcttgtcttatct
cccctggccaagggcttgttccacaaggccatttcagagagtggcactgtaaccctgggc
ttgttcactgaccagcctaaggaggatgcacaaaaaattgctgctgcctctggctgtgaa
aagtccagttcagctgcaatggttgaatgcttgagaggaaaaacagaagaagaactacta
cagataacactgaaaatggatttttttttgatcaatacttgtgtagatggtgcatttttt
ccaaaaagtcccaaggaattgctatctgaaaaatcaatgaatgaggtcccatacataata
ggagtaaataactgtgaattcggatgggtaattcctatggcaatgaaatatccttttgtg
gatggtctggagaaagatgttgcacgtcaaattttaaagagcaatttagcaaaattaaat
aagggccttacatctgaagttgtagacagagtgtacaaggagtacatggggcatgcagaa
agccctgctcaggtccgagatggcctcctggatgcaatgggagatgtctactttgtcatc
tcagctgtggaagtggccagataccacagagatgctggcaacccagtctacttctatgaa
ttccaacatcgaccgagttcaatggaaggtgtggtaccagagtttgtaaaagcagatcac
ggagctgagattgcctttgtctttggaaagccattcttagcaggaggtgctacaaaagaa
gaagataaactgagcagaactgtcatgagatactggaccaactttgctaaaaacggaaat
cccaacggagagggcttggtccattggcccctgtatgacctggaggaaaaatacctggga
atagacctggagcaaaaggcagcagagaaactgaaagaacatagaatgcagttttggcaa
cagctcatgaaacaaagccagactggaaggacaaaacacaccgatttataa

DBGET integrated database retrieval system