KEGG   Taeniopygia guttata (zebra finch): 100225731Help
Entry
100225731         CDS       T01082                                 

Gene name
USP38
Definition
ubiquitin specific peptidase 38
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100225731 (USP38)
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100225731 (USP38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 1019 aa AA seqDB search
MIVRRVVESAETPLSQAQCRAMFALGTRLVLQGPDPFQRQVGRQVLDAYGRFHRAEFEAF
FNRGLVLGLLQRGYGELSNRDPAILDYIQAGLRLIMSCPSVLELFELLQVEALRLVCERP
APPLCARLCQLLGDFPQCLPRGRKLSLAFCQQLVRSIAHFQSQGTREAELRLYVSQVTQV
SALLRSVWKAEPDTLLPSLQELFAVISATDTSFEPSVALASLVQHIPLQMITVLIRSLTT
DPNVKDASMTQALCRMIDWLSWPLAQHVETWVIALLKGLAAVQKFTILIDVTLLKIELVF
NRLWFPLVRPGALAVLSHMLLSFQHSPEAFHLIVPHVVSLVHSFKRDGLPSSTAFLMQLT
ELIHCMMYHYSGFPELYEPILEAIKDMPKPAEEKIKLILSQSAWTSQYSSLPSCLSRLSG
KSETGKTGLINLGNTCYMNSVIQALFMATDFRRHVLSLNLNGCNSLMRKLQHLFAFLAHT
QREAYAPRIFFEASRPPWFTPRSQQDCSEYLRFLLDRLHEEERTLKALSSAKSSESIMTD
KSQAQETAHKTQVYSEVPCMGSEERTLIEKMFGGKLKTNVCCLNCKSMSQKEEAFTDLSL
AFCPPTSLEKVDPKCIEHSEVKDDYMVQTNTSATSRAAETCLSNLEVNHGCDTIMNEGTI
GDFTSEPSSENTTISELKVENNGDMSQSLVGKNTLSVTDLLNYFLAPEILSGDNKYYCEK
CASLQNAEKTMQIIEEPEYLILTLLRFSYDPKCHIRRKILDNVSLPLILELPVKRATSPL
AVVSGGWSVGVEVSDTGENLAKKLKPSGADEVACPQLVPYVLSSVVVHSGVSSESGHYYS
YARNVTGSGPSGLCHQSTALSLVSPQDKLFTEDSPCTVVENELDTEMPREWFLFNDSRVT
FTSFQSVQKITSRFPKDTAYVLFYKKQNSTCGFNTNPANGLWVNGDPPLQKDLMDAITKD
NKLYLQEQELSARTQALQAASASCSFRPNGFDDNDPPGSCGPTGGGGGGGFSTVGRLVF
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtgcggcgcgtggtggagtcggcggagacgccgctgagccaggcgcagtgccgc
gccatgttcgcgctcggcacccggctggtgttgcagggtcccgacccgttccagcggcag
gtgggccggcaggtgctggacgcctacggccgctttcaccgcgccgagttcgaggcattc
ttcaaccgcgggctcgttctcggcctcctgcagcgcggctacggcgagctgagcaaccgc
gaccccgccatcctcgactacatccaggcgggcctgcgcctcatcatgagctgcccctcg
gtgctggagctcttcgagctgctgcaagtggaggcgctgcgcttggtgtgcgagcggccg
gcgccgccgctctgcgcccgcctctgccagctgctgggcgacttcccgcagtgcctgccc
cgcggcaggaagctctcgctcgccttctgccagcagctggtgcgcagcatcgcccacttc
cagagccagggcacccgcgaggccgagctgcgcctctacgtctcgcaggtgacccaggtc
agcgcgctgctcaggagcgtctggaaggccgagcccgacacgctgctgccctccctgcag
gaactcttcgctgtcatctctgccacggatacttcgtttgagccttctgttgcactggca
agtcttgtgcagcacataccattgcagatgattacagtactcatcaggagccttactaca
gatcctaatgtgaaagatgcaagtatgactcaagctctgtgcagaatgattgactggctg
tcctggcctctggctcagcacgtggaaacatgggtgattgcactgctgaaaggattggct
gcagtccagaaatttaccatcctcattgatgtcactctgcttaagattgaattggtcttt
aatcgactttggtttcctctagtgaggcctggtgcccttgctgttctttcccacatgtta
cttagtttccagcattctccagaagcttttcatttgattgtcccacacgtggtcagtttg
gttcactccttcaaaagagatggcttgccttccagtacagcctttttgatgcagttgact
gagttgatacactgtatgatgtatcattattcaggttttccagagctctatgaacccatt
ctggaagctattaaggatatgcccaaacccgctgaagagaagattaaattgatcctcagt
cagagtgcctggacttctcaatacagttctttgccatcttgtttatctagactttctgga
aaatctgaaactgggaagacaggcctaataaatctaggaaatacttgctacatgaacagt
gttattcaggcactttttatggctacagatttcagaagacatgttttatctctgaatcta
aatggctgtaattccctaatgagaaaattacagcatctttttgcatttttggcccatacc
cagagagaggcttatgctcctagaattttctttgaagcttccagaccaccatggttcact
cctcgatcccagcaggattgttcagaatatctcagattcctgctagacaggttgcatgaa
gaagagagaactttgaaagcgttgtcttcagccaagagttctgaaagtattatgactgac
aaatcccaggcacaagaaactgcccataaaacacaagtgtatagtgaagtaccttgtatg
ggaagtgaagaaagaactctgatagagaagatgtttggaggaaaattgaagactaacgtg
tgctgtttgaactgcaaaagtatgtctcaaaaggaagaagctttcacagatctctctttg
gctttctgtcccccaacttccttggaaaaagttgacccaaaatgcatagaacattctgaa
gtgaaagatgactacatggtgcaaactaatacttcagcaaccagtcgtgctgcagaaaca
tgtctcagtaatttggaagtaaatcatggatgtgacacaataatgaatgaaggaaccata
ggagattttactagtgagccaagctctgagaataccacaatttctgaactcaaagttgaa
aataacggggatatgtctcagagtctagtaggtaaaaataccctgtcagttacagactta
ctcaattattttctggcacctgagatccttagtggagacaacaaatattattgtgaaaag
tgtgcctctctacagaatgctgaaaaaactatgcagatcattgaggaacctgaatacctc
atcctcactcttttgagattttcatatgatccaaagtgtcacataaggcgcaaaatcttg
gacaatgtttctctaccacttatattggaactgccagtgaaaagagcaacatccccttta
gctgttgtttcaggaggctggtctgttggtgtggaggtttctgatactggagaaaacctt
gctaaaaaactgaagccctctggtgctgatgaagtggcctgcccacaactggtgccctat
gtgttgagctctgtggtggtgcattctggtgtatcctctgaaagtggacattattattca
tatgctagaaatgttactgggtcagggccttcagggctctgccaccagtctacagctctt
tctttagtttctcctcaggataagttgtttacagaggatagtccttgtactgttgtagaa
aatgagctggacactgagatgccaagagaatggtttctgttcaatgacagcagagtgaca
tttacctcatttcagtcagtccagaaaatcaccagtagatttccaaaggacactgcttat
gttctgttttacaaaaagcagaacagcacctgtggcttcaacaccaatccagcaaatggc
ctctgggtaaatggagaccctcctctacaaaaagacctcatggatgcaattacgaaagat
aacaaactatacttgcaggagcaagagcttagtgctcgaacacaagcacttcaagctgcc
tcagcctcttgctctttccgacccaatggatttgatgacaatgatcccccgggaagttgt
gggccgacaggtggaggaggagggggtgggttcagtaccgtcggtagattggtcttttga

DBGET integrated database retrieval system