KEGG   Taeniopygia guttata (zebra finch): 100225770Help
Entry
100225770         CDS       T01082                                 

Gene name
CHKA
Definition
(RefSeq) choline kinase alpha
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00564  Glycerophospholipid metabolism
tgu01100  Metabolic pathways
Module
tgu_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
tgu_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100225770 (CHKA)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100225770 (CHKA)
    2.7.1.82  ethanolamine kinase
     100225770 (CHKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase Kdo Helo_like_N
Motif
Other DBs
NCBI-GeneID: 100225770
NCBI-ProteinID: XP_002199515
Ensembl: ENSTGUG00000009915
Position
5
AA seq 440 aa AA seqDB search
MKTKFCNGDADPSPLRLLLGRGSAATGQPPSPLAHPDPEGKDPTVAGRATPPPALPPPLE
EESPPLDPRTRRRAYLWCKEFLPGAWRGLREEQLCISPIRGGLSNMLFQCSLPDTIETVA
DEPRKVLLRLYGAILQMRSCNKGECVQSQKENDLQGAEAMVLESVMFAILAERALGPKLY
GIFPQGRLEEFIPSRKLTTEELSLPDISAEIAEKMARFHGMKMPFNKEPKWLFGTMEKYL
NQVLRIKFTRECQTRKLNKLLSYNLPQEMKNLRAMLEATSSPVVFCHNDCQEGNILLLEG
RESSENQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSYEKYPFFKASVPKYPSKKQQLH
FLSSYLSAFHDGFEDLSNDEKSELEEEVLVEVNRFALASHFFWGLWSIIQAKISSIEFGY
LEYALSRFDAYFDQKRKLNV
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagttctgcaacggcgacgccgacccgtccccgctcaggctcctccttggc
cgcgggtccgccgcgaccggtcagccgccctcaccactggctcaccccgaccccgagggg
aaggatcccaccgtggcgggtagagcgaccccgcccccggcgctgcctccgccgctcgag
gaggagtcgccgccgctcgacccccggacgcggcgccgggcgtatctgtggtgcaaggag
ttcctgccgggggcctggcgggggctgcgggaagagcagctgtgcatcagccccatcaga
ggcggcctcagcaacatgctgtttcagtgctcgctacctgataccattgagacagttgca
gatgagccacggaaagttctcctgcgtttatatggtgcaatcctgcagatgaggtcctgt
aataagggagagtgtgttcagtctcagaaggaaaatgacttacaaggagcagaagccatg
gttctggaaagtgttatgtttgccattcttgcagagagagcactcggcccaaagctgtat
ggaatcttcccacaagggcgactggaggaattcattcccagcagaaaactgaccactgaa
gaactaagcttacctgacatctctgctgaaatagctgagaagatggccagatttcatggc
atgaaaatgccatttaataaggaacctaagtggctttttggaacaatggaaaagtatcta
aatcaagtgttgaggattaaatttaccagagaatgccaaaccagaaaactaaacaaactt
ctcagttacaatctcccccaggaaatgaaaaatctaagagctatgcttgaagctacttct
tcaccagtcgtattttgccacaatgattgtcaagagggtaatatcttacttctggaaggc
agagagagttcagaaaaccaaaagctgatgctcattgactttgaatacagcagctataat
taccgaggatttgacattggaaatcacttctgtgaatggatgtatgattactcatatgag
aagtacccattcttcaaagccagtgttcctaaatatccttcaaagaaacagcagcttcat
ttcctctccagttacctgtctgcattccatgatggctttgaagatctcagtaatgatgag
aagtctgaactagaagaagaagtgttggtagaagttaacaggtttgcccttgcatcacac
ttcttctggggtctgtggtctattatacaagcaaagatctcatccattgagtttgggtac
ctggaatatgcgttatccagatttgatgcctactttgatcagaagaggaagctgaatgtg
tga

DBGET integrated database retrieval system