KEGG   Taeniopygia guttata (zebra finch): 100225827Help
Entry
100225827         CDS       T01082                                 

Gene name
SUV39H2
Definition
suppressor of variegation 3-9 homolog 2 (Drosophila)
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100225827 (SUV39H2)
Enzymes [BR:tgu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100225827 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1A
AA seq 417 aa AA seqDB search
MGCPGEVVKSPSLEVFTWYVPCLASLETLQELCRKENLTCKSIGITNRNLKSYEVEYLCD
YKVEEGKAFYLVKWKGWPESSNTWEPRKHLNCPLLIQNFLRDRNEYLSRGRGGKAMKLRK
HVKTLKPAIADYIVKKAKQRIALQRWKEELNRKKNHKAMILVENTVDLEGPPLDFYYINE
YKPAPGINVLNGITTGCECDDCPAEKCCPKEAGFILAYNKRKKLKIQPGLPIYECNSYCR
CGPDCLNRIVQKGTPYSLCIFRTNNGRGWGVKTLQKIKTNSFVMEYVGEVITSEEAERRG
QFYDNQGNTYLFDLDYDSDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDLRLPRI
ALFSTRTIKAGEELTFDYQMKGSIDLTSDSAEGLTPSKKSIRTVCKCGAMCCRGYLN
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcccgggggaggtggtgaagtcaccgtccctggaggtgttcacctggtatgtg
ccatgtctagcttcacttgagaccctccaagaattatgtaggaaggaaaatctcacatgt
aaatccattggaatcaccaacaggaatctaaagagttatgaggtggaatatttgtgtgac
tacaaggtagaagagggcaaagcattctatcttgtgaaatggaaaggatggccagaatct
tcaaatacttgggaacctcggaaacatctgaactgtcctctgcttattcagaactttctt
agagacagaaatgaatacttgtctcgggggaggggaggcaaagcaatgaaactgagaaag
catgttaaaactttgaaacctgcaattgcagattatattgtaaagaaggccaaacaaaga
atagctctgcagaggtggaaagaagaactcaacaggaaaaagaatcacaaagcaatgatt
ctggtagaaaacactgtagatcttgaaggccctcctttagacttctactacatcaatgag
tataaacctgctccaggaataaatgtgctcaatggaataacaactggctgcgagtgtgat
gactgccctgctgagaagtgctgtccaaaggaggctgggtttattttggcttacaataaa
cgtaagaaattgaaaatccagcctggcttgcccatctatgagtgcaattcgtattgtagg
tgtgggcctgactgcctgaataggattgtgcagaaagggaccccatattcactctgcatc
ttcagaaccaacaacggccgtggctggggagtaaaaaccctccagaaaattaaaaccaac
agttttgtgatggagtatgttggagaggtgattacaagtgaggaagcagagaggcgaggc
cagttctatgacaaccagggaaatacatacctgtttgatttggactatgactcagatgaa
tttacagtagatgcagctcgatatggaaatgtgtcccattttgtgaaccacagttgtgat
ccaaatcttcaagtcttcaatgtgtttattgataacctcgacttgcgtcttcctcgaata
gcgctgttctctacccgaaccatcaaggctggagaagagctaacctttgactatcagatg
aaaggttcaatagatctgacttcagactctgctgaaggtcttaccccatccaaaaagagc
atcagaactgtctgtaaatgtggagccatgtgttgcagaggttatctcaactga

DBGET integrated database retrieval system