KEGG   Taeniopygia guttata (zebra finch): 100225827Help
Entry
100225827         CDS       T01082                                 

Gene name
SUV39H2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2 (Drosophila)
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100225827 (SUV39H2)
Enzymes [BR:tgu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100225827 (SUV39H2)
Chromosome [BR:tgu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100225827 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100225827 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1A
AA seq 417 aa AA seqDB search
MGCPGEVVKSPSLEVFTWYVPCLASLETLQELCRKENLTCKSIGITNRNLKSYEVEYLCD
YKVEEGKAFYLVKWKGWPESSNTWEPRKHLNCPLLIQNFLRDRNEYLSRGRGGKAMKLRK
HVKTLKPAIADYIVKKAKQRIALQRWKEELNRKKNHKAMILVENTVDLEGPPLDFYYINE
YKPAPGINVLNGITTGCECDDCPAEKCCPKEAGFILAYNKRKKLKIQPGLPIYECNSYCR
CGPDCLNRIVQKGTPYSLCIFRTNNGRGWGVKTLQKIKTNSFVMEYVGEVITSEEAERRG
QFYDNQGNTYLFDLDYDSDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDLRLPRI
ALFSTRTIKAGEELTFDYQMKGSIDLTSDSAEGLTPSKKSIRTVCKCGAMCCRGYLN
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcccgggggaggtggtgaagtcaccgtccctggaggtgttcacctggtatgtg
ccatgtctagcttcacttgagaccctccaagaattatgtaggaaggaaaatctcacatgt
aaatccattggaatcaccaacaggaatctaaagagttatgaggtggaatatttgtgtgac
tacaaggtagaagagggcaaagcattctatcttgtgaaatggaaaggatggccagaatct
tcaaatacttgggaacctcggaaacatctgaactgtcctctgcttattcagaactttctt
agagacagaaatgaatacttgtctcgggggaggggaggcaaagcaatgaaactgagaaag
catgttaaaactttgaaacctgcaattgcagattatattgtaaagaaggccaaacaaaga
atagctctgcagaggtggaaagaagaactcaacaggaaaaagaatcacaaagcaatgatt
ctggtagaaaacactgtagatcttgaaggccctcctttagacttctactacatcaatgag
tataaacctgctccaggaataaatgtgctcaatggaataacaactggctgcgagtgtgat
gactgccctgctgagaagtgctgtccaaaggaggctgggtttattttggcttacaataaa
cgtaagaaattgaaaatccagcctggcttgcccatctatgagtgcaattcgtattgtagg
tgtgggcctgactgcctgaataggattgtgcagaaagggaccccatattcactctgcatc
ttcagaaccaacaacggccgtggctggggagtaaaaaccctccagaaaattaaaaccaac
agttttgtgatggagtatgttggagaggtgattacaagtgaggaagcagagaggcgaggc
cagttctatgacaaccagggaaatacatacctgtttgatttggactatgactcagatgaa
tttacagtagatgcagctcgatatggaaatgtgtcccattttgtgaaccacagttgtgat
ccaaatcttcaagtcttcaatgtgtttattgataacctcgacttgcgtcttcctcgaata
gcgctgttctctacccgaaccatcaaggctggagaagagctaacctttgactatcagatg
aaaggttcaatagatctgacttcagactctgctgaaggtcttaccccatccaaaaagagc
atcagaactgtctgtaaatgtggagccatgtgttgcagaggttatctcaactga

DBGET integrated database retrieval system