KEGG   Taeniopygia guttata (zebra finch): 100225845Help
Entry
100225845         CDS       T01082                                 

Gene name
CHP1
Definition
(RefSeq) calcineurin-like EF-hand protein 1
  KO
K17610  
calcineurin B homologous protein 1
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Protein phosphatases and associated proteins [BR:tgu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100225845 (CHP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 195 aa AA seqDB search
MGSRASICCRREIVEIKKRRAVISHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDQNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFAEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggttcccgggcgtcaatctgttgcagacgagagatcgtagagatcaagaagagacgg
gctgtgatctcccacagtcaaatcacccgtctgtacagtcgcttcaccagtctggacaaa
ggagaaaatggcactcttagccgtgaagacttccagcggattccagagcttgccatcaat
ccactcggagacagaattatcaacgccttctttccagaaggagaggaccaggtgaatttc
cgtggattcatgaggacactagcccacttccgacccatagaagataatgaaaagagcaaa
gaccagaatggaccagaaccgctgaacagcagaagtaacaagctccactttgcttttcga
ttatatgatctagataaagatgacaaaatttccagggatgagctcctccaggtattacgg
atgatggttggtgtaaatatttctgatgaacagctgggcagcattgctgacaggacaatc
caggaagctgatcaagatggagatagtgccatctcctttgcagaatttgtaaaggttttg
gagaaggtggatgtagagcagaaaatgagcattcgattccttcactga

DBGET integrated database retrieval system