KEGG   Taeniopygia guttata (zebra finch): 100225893Help
Entry
100225893         CDS       T01082                                 

Gene name
TYR
Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100225893 (TYR)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    100225893 (TYR)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100225893 (TYR)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     100225893 (TYR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 537 aa AA seqDB search
MLSCCSVSMLLFALGFLLVILQPSTGQFPRVCANVQSLLSKECCPPWDGDGSPCGELSSR
GSCQNILLSQAPLGPQFPFSGVDDREDWPSVFYNRTCRCEGNFMGFSCGECKFGFSGINC
TERQVKTRRNIFQLTISEKNKFLAYLNLAKNIPSQDYVIATGTYAQMNNGSNPMFRDISV
YDLFVWMHYYASRDTLLGGSNVWRDIDFAHEAPGFLPWHRVFLLMWERQIQRITGDENFT
IPYWDWRDAEDCEVCNDEYMGGRHPTNPNLLSPASIFSSWQVICTQSEEYNSQQALCSAT
SEGPIRRNPGNNDKSRTPRLPSSADVEFCLSLTQYESGPMDKMANYSFRNTLEGFADPQT
AISNPAQSGLHNALHIYMNGSMSQVQGSANDPIFVLHHAFVDSIFERWLRRHRPMLEVYP
AAHAPIGHNRENYMVPFIPLYRNGEFFKSSRELGYDYEYLQEPALQSFQDFLTPYLQQAR
QIWAWLVGAAVFGGIVTAVLTGLIRACQKKKGETSSEIQPLLIESEDYNNISYQSNF
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgctctcctgctgctctgtcagtatgctgctatttgccctgggttttctgctcgtcatc
cttcagccatccactgggcagttccccagagtctgtgcgaacgtgcagagtttgctgagc
aaggagtgctgtcccccctgggatggagacggatccccttgtggggagctttccagcaga
gggtcctgccagaacatccttctctcccaggctccactgggaccacagttccctttttca
ggagtggatgacagagaggactggccctctgtattttacaaccggacttgtagatgtgaa
ggcaacttcatgggattcagctgtggagagtgcaaatttggcttctccgggatcaactgc
actgaaaggcaagtgaaaacaagaagaaacatcttccagctcaccatcagcgagaagaac
aagtttcttgcctatcttaacttggcaaaaaacatccctagccaggactatgttattgct
accggcacatatgctcagatgaacaatggctccaaccccatgttcagagacatcagtgtg
tatgatctctttgtgtggatgcattattatgcctcccgagacacactcttaggtgggtcc
aatgtgtggcgggacatcgattttgcccacgaagcccctggtttcctgccttggcatcgg
gtctttctgctgatgtgggaacgtcagatccagaggataacaggtgatgagaacttcacc
atcccctactgggactggcgagatgcagaggactgtgaggtctgcaatgatgagtacatg
ggcggcagacatcccaccaaccctaatttactcagcccagcatcaattttctcctcatgg
caggtaatttgcactcagtctgaagagtacaacagccaacaggctttatgcagtgccaca
agtgagggacctataaggagaaatcctggaaacaacgataaatcaaggaccccgaggctc
ccatcctcagctgatgtcgaattttgcctttcactgactcagtatgaatctggacccatg
gataaaatggccaattacagtttccgaaacactttggaaggctttgctgatccacagact
gcgatatcaaacccagcacaaagcggtttgcataacgcgcttcacatctacatgaatggc
tccatgtcccaagtacaaggctctgcaaatgatcctatctttgtattacaccacgcattt
gtggacagcatttttgaacgatggttaagaagacacaggcccatgctagaagtataccca
gcagctcatgcaccaattgggcacaatcgagaaaattacatggtccccttcattcctctt
tatagaaatggagaatttttcaaatcctcaagagagctggggtatgactatgaatatctg
caagaaccagcccttcagtctttccaagactttttgacaccctatcttcagcaagcccgt
cagatctgggcttggttggtcggagcagctgtgtttggaggcattgttactgctgtgctc
acagggctcatcagggcgtgccagaagaaaaaaggagaaacttcttcagagatacaaccc
ttgctcatagaaagtgaagattacaacaatataagttaccaatccaatttctag

DBGET integrated database retrieval system