KEGG   Taeniopygia guttata (zebra finch): 100225946Help
Entry
100225946         CDS       T01082                                 

Definition
embryonic pepsinogen-like
Orthology
K01378  
chymosin [EC:3.4.23.4]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.4  chymosin
     100225946
Peptidases [BR:tgu01002]
 Aspartic Peptidases
  Family A1: pepsin family
   100225946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
26
AA seq 342 aa AA seqDB search
MWPLLLLCAASALCQGVTRLPLERGKKLRDVLREKDLLHQFFQHHHYDIGTKFPHAFPNG
TRVATEPLLNTLDVEYYGTISIGTPPQDFSVVFDTGSSDLWVPSVSCPSLACRTHQVFDP
SQSSTYKSTGLSLSIHYGTGEMEGIVGSDTVTVASLVDTNQLFGLSTAEPGQFFVDVQFD
GILGLGYPNLAADGVTPVFDNLVNQSLLQENLFSVYLSRDTEGSVVIFGGIDESYFTGPI
NWIPVSYQGYWQISMDSIIVNSQEVACAGGCQAIIDTGTFVIDGVQYPVSAMAYTEQNNQ
ESCMSSFQDTSGDLWILGDVFIRVYYSIFDRANNRVGLAKAV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtggcccctcctgctcctctgcgctgcctctgccctctgccagggtgtcaccaggctg
cccttggagagggggaagaagctgagagatgtcctcagggagaaggatttgctgcaccag
ttcttccagcatcaccactacgacatcggcaccaaattcccacatgcttttcccaatgga
accagggtggccaccgagcctctgctgaacaccctcgacgtggaatactacgggaccatc
tccatcggcacccccccgcaggacttcagcgtggtcttcgacaccggctcctccgacctc
tgggtcccctctgtgtcctgccccagcctggcttgccgaacccaccaggtgtttgacccc
tctcagtcctccacctacaagagcacggggctgagtctgtccatccactatggcacgggc
gagatggaggggatcgtgggctccgacaccgtcaccgtggcctctctggtggacaccaac
cagctcttcggcctgagcaccgccgagcccggccagttcttcgttgacgtccaatttgat
gggatcctgggcttgggatacccaaacctggctgctgatggcgtcacgccggtctttgat
aacctggtgaaccagagcttgctgcaggagaacctcttctctgtctacctgtcccgtgac
acagaagggagcgtggtcatcttcgggggcattgatgagtcctatttcactggccccatc
aactggatccctgtctcttaccagggctactggcagatctccatggacagcatcattgtg
aacagccaggaggtcgcgtgtgctggtggctgccaggccatcatcgacaccggcactttt
gtcatcgacggggtccagtaccccgtgtctgccatggcctacaccgagcagaacaaccaa
gaatcttgcatgagcagcttccaggacacctctggggacctctggatcttgggagatgtc
ttcatcagggtgtattacagcatctttgaccgggccaacaaccgcgttgggctggccaag
gctgtttag

DBGET integrated database retrieval system