KEGG   Taeniopygia guttata (zebra finch): 100225954Help
Entry
100225954         CDS       T01082                                 

Gene name
BDH1
Definition
3-hydroxybutyrate dehydrogenase, type 1
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100225954 (BDH1)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    100225954 (BDH1)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     100225954 (BDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 343 aa AA seqDB search
MLATKLSRPLLNFSVKALNFKDPGNGFRPVQRFSFPLLSPCGSRSYANEVDQIGSRAVLI
TGCDSGFGFALAKHLHDKGFIIYAGCLQKDKGEGGSKELDAMKSDRMRTVQLNVCDSKEM
DRAVEHVQNSLKDPEKGLWGLVNNAGISTFGEVEFTSMDTYMEVAEVNLWGTVRTTKAFL
PLIRRSKGRVVNISSMMGRMGSPARSPYCITKFGVEAFSDCLRYEMQPQGVMVSIVEPGN
FIAGTNLYSPERIKAIADKMWDELPEIVRKDYGRKYFDEQVSKMESYCNSGSRDTSPVIE
SVEHALTSTAPYTRYHPMDYYWWLRMQIMTHMPAAISDRLYVY
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgttggccaccaagctgtcccgccctctcttgaacttctctgtgaaagccctgaatttc
aaggacccggggaatggcttcaggcccgtgcagagattttccttccctctcttgtcccca
tgtggcagccgctcttatgcaaatgaagtcgatcagattggcagtagagctgtgcttata
acaggctgtgactcaggatttggatttgccttggccaagcacctacatgacaaaggtttc
attatttatgctggctgcctgcaaaaggacaagggggagggtggctccaaggagctggat
gccatgaagagtgatcgaatgagaactgtccagctcaacgtctgtgacagcaaagaaatg
gaccgggcagtggagcatgtgcaaaacagcctcaaggaccctgagaaagggctctggggg
ctggttaacaatgctgggatctccacatttggggaagttgaattcaccagcatggacacc
tacatggaggtagctgaagtgaacctgtgggggaccgtgcgaaccaccaaggctttcctc
ccgctcatccggaggtcaaagggtcgcgtggtgaacatcagcagcatgatggggcggatg
ggcagccccgcccgctcgccctactgcatcaccaagttcggcgtggaagccttctccgac
tgcctgcgctacgagatgcagccccagggcgtcatggtcagcatcgtggagcccggcaac
ttcatcgccggcaccaacctgtacagccccgagcgcatcaaagccatcgccgacaagatg
tgggacgagctccccgagatcgtgcgcaaggactacggcaggaagtacttcgacgagcag
gtcagcaagatggagtcatactgcaacagtggctcgagggacacctcgccggtcatcgag
agcgtggagcacgcgctcacctccacggccccctacacccgctaccaccccatggattac
tactggtggctgcgcatgcagatcatgacccacatgcccgctgccatctcagaccggctc
tacgtctactga

DBGET integrated database retrieval system