KEGG   Taeniopygia guttata (zebra finch): 100225992Help
Entry
100225992         CDS       T01082                                 

Gene name
ANGPT2
Definition
angiopoietin 2
Orthology
K05466  
angiopoietin 2
Organism
tgu  Taeniopygia guttata (zebra finch)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 495 aa AA seqDB search
MQLAACFFLGCGIFLASGYNSFSKSMETIGKKQYQVQHGSCSYTFLLPEADNCRSSAPYV
SNAVQRDAPLDYDDSVQRLQLLENIMENNTQWLMKLENYIQDSMKKEMVEIQQTAVQNQT
AVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLERQISDQTNEI
TKLQEKNSFLEKRVLEMEDKHMLQLKSIKDEKDQLQVLVARQNSIIEELEKQLVTATVNN
SVLQKQQHDLMETVHSLLTMISTPNSAKNKFIAKEEQISFKDCAEAFKSGLTTSGIYTLT
VSNTAQEKKAYCDMETGGGGWTVIQKREDGSVDFHRTWKEYKMGFGDPAGEYWLGNEFVS
QLTNQKRYVLKIQLKDWEGNEAYSLYDHFSLASEEQKYRIYLKGLTGTAGKISSISQPGN
DFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPLRQNNNKFNGIKWYYWKGSG
YSLKSTTMMIRPADF
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcagctggccgcctgcttctttttgggctgcggcatattcttagcttcaggatacaac
tccttcagtaagagcatggagacgataggcaagaagcagtaccaggttcagcacgggtcc
tgcagctacaccttccttctgcccgaggcggacaactgccgctcctccgctccgtacgtg
tccaacgcggtgcagagggatgcacctctggactatgacgattcagttcaaagactgcag
ctacttgagaacatcatggaaaacaacactcagtggctaatgaagcttgagaattacatc
caagacagcatgaagaaagaaatggtagagatccagcaaactgcagtgcagaaccagact
gcagtaatgattgaaataggcacaaacttgctaaatcaaacagctgaacagacccgcaaa
ttaacagatgttgaagcacaagtattaaaccagacaacccgacttgaacttcagcttttg
gaacactctctttcaacaaacaaactagaaagacagatttcagatcagaccaatgagata
actaaattacaagaaaaaaacagctttttagaaaaaagagttcttgagatggaagacaag
cacatgcttcagctgaagtcaataaaagatgaaaaagatcagcttcaagtcctagtagcc
agacagaattctattatagaagaactagaaaaacagttagttacagctacagtaaacaac
tcagttctgcaaaaacagcaacatgatctgatggagacggttcatagcttgcttactatg
atatcgacaccaaactcagctaagaacaaattcatagccaaagaggagcaaatcagcttc
aaagactgtgctgaagctttcaaatctggactgacaacaagtggaatctacactctaaca
gtttcaaacactgcacaagagaagaaggcctactgtgacatggaaactggtggaggaggc
tggacagttattcagaaacgagaagatggcagtgtggacttccaccggacgtggaaggag
tacaagatgggatttggtgatcctgctggggagtactggctgggaaatgagtttgtttct
caactaactaatcagaagcgttacgttcttaaaatacaactgaaagactgggaaggaaac
gaggcatattcattgtatgaccacttctctctagcaagtgaagaacaaaaatacaggatt
taccttaaaggacttactgggacagcgggcaaaataagcagtataagccaaccaggaaat
gattttagcacaaaggatgcagacaatgacaaatgtatttgcaaatgttcacaaatgcta
acaggaggatggtggtttgatgcatgtggtccttctaacctcaatggaatgtattatcca
ttacgacagaacaacaacaagtttaacgggatcaagtggtactactggaagggctcagga
tactctctcaaatctacgactatgatgattcgaccagcagatttctaa

DBGET integrated database retrieval system