KEGG   Taeniopygia guttata (zebra finch): 100225992Help
Entry
100225992         CDS       T01082                                 

Gene name
ANGPT2
Definition
(RefSeq) angiopoietin 2
  KO
K05466  angiopoietin 2
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100225992 (ANGPT2)
Cytokines and growth factors [BR:tgu04052]
 Growth factors
  Growth factors (RTK binding)
   100225992 (ANGPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C DivIC SlyX
Motif
Other DBs
NCBI-GeneID: 100225992
NCBI-ProteinID: XP_004176901
Ensembl: ENSTGUG00000012892
Position
3
AA seq 494 aa AA seqDB search
MQLAACFFLGCGIFLASGYNSFSKSMETIGKKQYQVQHGSCSYTFLLPEADNCRSSAPYV
SNAVQRDAPLDYDDSVQRLQLLENIMENNTQWLMKLENYIQDSMKKEMVEIQQTAVQNQT
AVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLERQISDQTNEI
TKLQEKNSFLEKRVLEMEDKHMLQLKSIKDEKDQLQVLVARQNSIIEELEKQLVTATVNN
SVLQKQQHDLMETVHSLLTMISTPNSKNKFIAKEEQISFKDCAEAFKSGLTTSGIYTLTV
SNTAQEKKAYCDMETGGGGWTVIQKREDGSVDFHRTWKEYKMGFGDPAGEYWLGNEFVSQ
LTNQKRYVLKIQLKDWEGNEAYSLYDHFSLASEEQKYRIYLKGLTGTAGKISSISQPGND
FSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPLRQNNNKFNGIKWYYWKGSGY
SLKSTTMMIRPADF
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcagctggccgcctgcttctttttgggctgcggcatattcttagcttcaggatacaac
tccttcagtaagagcatggagacgataggcaagaagcagtaccaggttcagcacgggtcc
tgcagctacaccttccttctgcccgaggcggacaactgccgctcctccgctccgtacgtg
tccaacgcggtgcagagggatgcacctctggactatgacgattcagttcaaagactgcag
ctacttgagaacatcatggaaaacaacactcagtggctaatgaagcttgagaattacatc
caagacagcatgaagaaagaaatggtagagatccagcaaactgcagtgcagaaccagact
gcagtaatgattgaaataggcacaaacttgctaaatcaaacagctgaacagacccgcaaa
ttaacagatgttgaagcacaagtattaaaccagacaacccgacttgaacttcagcttttg
gaacactctctttcaacaaacaaactagaaagacagatttcagatcagaccaatgagata
actaaattacaagaaaaaaacagctttttagaaaaaagagttcttgagatggaagacaag
cacatgcttcagctgaagtcaataaaagatgaaaaagatcagcttcaagtcctagtagcc
agacagaattctattatagaagaactagaaaaacagttagttacagctacagtaaacaac
tcagttctgcaaaaacagcaacatgatctgatggagacggttcatagcttgcttactatg
atatcgacaccaaactctaagaacaaattcatagccaaagaggagcaaatcagcttcaaa
gactgtgctgaagctttcaaatctggactgacaacaagtggaatctacactctaacagtt
tcaaacactgcacaagagaagaaggcctactgtgacatggaaactggtggaggaggctgg
acagttattcagaaacgagaagatggcagtgtggacttccaccggacgtggaaggagtac
aagatgggatttggtgatcctgctggggagtactggctgggaaatgagtttgtttctcaa
ctaactaatcagaagcgttacgttcttaaaatacaactgaaagactgggaaggaaacgag
gcatattcattgtatgaccacttctctctagcaagtgaagaacaaaaatacaggatttac
cttaaaggacttactgggacagcgggcaaaataagcagtataagccaaccaggaaatgat
tttagcacaaaggatgcagacaatgacaaatgtatttgcaaatgttcacaaatgctaaca
ggaggatggtggtttgatgcatgtggtccttctaacctcaatggaatgtattatccatta
cgacagaacaacaacaagtttaacgggatcaagtggtactactggaagggctcaggatac
tctctcaaatctacgactatgatgattcgaccagcagatttctaa

DBGET integrated database retrieval system