KEGG   Taeniopygia guttata (zebra finch): 100226034Help
Entry
100226034         CDS       T01082                                 

Definition
cytochrome P450 3A13-like
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100226034
   00591 Linoleic acid metabolism
    100226034
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100226034
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100226034
Cytochrome P450 [BR:tgu00199]
 Cytochrome P450, animal type
  CYP3 family
   100226034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 510 aa AA seqDB search
MKLLPFFSTETWALILLLVALLLVYGIWPFGVFKKLGIPGPRPLPFLGTSLEYRKGFLEF
DTECFKKYGKIWGIYDGRQPTLAVTDPQIIKSVLVKDCYTTFTNRRRTDLAGVLNNAVSL
AEDEHWKRLRTVLSPTFTSGKLKEMFPIMKHYGEALVENVQKQVKEGSSISVKDIFGSYS
MDVVTSTSFGVNIDSMNNPKDPFVREMKKLVKFDFFNPVFILSFAFPFLIPVMAKMNVNI
FPSDAVDFFMRSLAKIKQDREKEAHKGRVDFLQLMIESQRSASQGNNEANHSYKALTDTE
VLAQAFIFIFAGYEPTSNTLGFLAYELAMHPDVQEKVLQEIDTVLPNKAPLTYEAITKLE
YLDMTVNETLRIYPLGGRIERTCKKDVEINGVNIPKGVVVTIPPYVLHRDPEYWPNPDEF
RPERFSKENKESIDPYTYLPFGAGPRNCIGMRFALLILKVAIVSLLQHFTFQTCKETQTP
IKLSSVGLLTPEKPIILKLVPRTSTEPAKN
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttctgccttttttctctacagaaacatgggctcttatactacttcttgtggct
ctcctgctagtatatgggatctggccatttggtgtgttcaagaagttgggcattcctggg
ccaagacctctgcctttcttggggacatctctggaatatcgcaaaggtttcctggaattt
gacacagaatgtttcaagaaatacgggaaaatctgggggatttacgatggcagacaaccc
acgctggccgtcacagacccccagatcatcaaatctgtgctggttaaagactgttacacc
accttcaccaaccgcaggcgcacggacctggccggggtactgaacaatgccgtctcatta
gctgaagatgagcactggaagaggctccgtactgtgctctctccaaccttcaccagcggg
aaactaaaggagatgttccctataatgaagcactatggggaagctttggtggagaatgtt
caaaagcaagtgaaagagggcagttcaatatctgtaaaggacatctttgggagttacagc
atggacgtggtcaccagcacttcctttggtgtgaacattgactccatgaacaaccccaag
gacccctttgtcagagagatgaagaaactggtcaagtttgacttttttaacccagtcttc
atattgtcatttgctttcccattccttattcctgtcatggccaagatgaacgtaaacatc
ttccccagtgatgctgtagattttttcatgagatcccttgccaaaattaagcaggatcgt
gaaaaggaagctcacaagggcagggtagacttcctgcagctgatgatcgaatcccagcgc
tcagccagccagggcaacaacgaagcaaatcactcatataaagccctgaccgacacagag
gtcctggctcaggcattcatctttatctttgctgggtatgaacccaccagcaacaccctc
ggtttcctggcctatgagctggccatgcaccctgatgtgcaggaaaaagtgctgcaggag
attgacacagtcctgcccaacaaggctcctctcacgtacgaagcaattacgaaattggaa
tatcttgacatgacagtgaatgaaaccctccggatctatcccctcggggggcggattgag
agaacctgcaagaaagacgtggagataaatggagtgaacattcccaaaggagtcgtggtc
acaatcccaccctacgtcctgcaccgcgaccccgagtactggcccaacccagatgagttc
aggccagaaaggttcagtaaggagaacaaggagtccatagacccgtacacatacctgcca
tttggggctgggcccaggaactgcattgggatgaggtttgctctcctgattctgaaagtc
gccatcgtctccctgctgcagcatttcaccttccagacctgcaaagagactcagacacca
atcaagctgagttcagtggggctcctaacaccagagaagccaattattctgaagttagtg
ccccggaccagcactgagcctgccaagaactga

DBGET integrated database retrieval system