KEGG   Taeniopygia guttata (zebra finch): 100226037Help
Entry
100226037         CDS       T01082                                 

Gene name
EEF2K
Definition
eukaryotic elongation factor-2 kinase
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     100226037 (EEF2K)
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   100226037 (EEF2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 719 aa AA seqDB search
MADEDLIFRMEGIDNARTTPVDSGNYLDADSDDEDNYFICPITDDPVSNKSANTKVDNYY
SSLAKTEQYSSSSSPRSFSFKETWKHAIEKAKHMPDPWAEFHLEDIETEHATRYRYNAVT
GDWVEDEVLIKMASQPFGRGAMRECFRTKKLSNFLHTQNWKGAYNYVAKQYIESVSRDVY
FEDVRLQMEAKLWGEEYNRHKPPKQVDIVQTCIIEMKNRPGKPLFHLEHYIEGKYIKYNS
NSGFVRDDSIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTESGKDFGDGNLG
VRGMALFFHSHFCNNICKSMGLAPFDLSSKEKDALDYNKKLLESAQTILRGTEEKCGSSR
VRTVSGSRPPLLFRLSENSGDESMSDVAFDSLPCSPSSATPHSHKVDMLNWPVFSEVDNL
DHFDNKRDFENGGDSGCPSEKRSETEDLDHRERGHSNNNQKQESDEDSLGSSARISVEKW
NLYNSSRVHIHRPSCVAQEIQRLNALELEKKIGKSVLGKVHLAMVRYHEAGRFCEKDKEW
DQESALFHLEHAADCGELEAIVGLGLMCSQLPHHILSEVTLEDTKENRNKGFNYLLRAAE
AGDRPSMILVARAYDTGVNLGADRAQDWKEALHWYNAALNMTDYDEGGEYDGTQDEPRYL
LLAREAEMLMMGGFNLDKDPQRSGELYTEAAEAAMEAMKGRLANQYYQKAEEAWAMMEE
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaggaccttattttccgtatggaagggattgataatgccagaacgactcca
gtggactctgggaattatcttgatgctgatagtgatgatgaagacaattattttatctgt
ccaataactgatgatccagtttctaacaagtctgccaataccaaagtagacaattactac
agcagcttagcaaaaactgagcagtacagttcaagctcttcccccagaagctttagcttt
aaggaaacctggaaacatgctattgagaaagccaagcatatgcctgatccctgggcagaa
tttcacctggaggacattgagacagagcatgccactcgctacaggtacaatgcagttact
ggggactgggttgaagatgaagtccttataaagatggcttctcaacctttcggccgtgga
gcaatgcgagagtgtttcagaacaaaaaagctgtccaacttcttacacactcagaactgg
aaaggtgcctataattatgttgccaagcaatacatagagagtgtgagcagagatgtttat
tttgaggatgttcgactgcagatggaagcaaaactctggggagaagagtacaaccggcac
aagccaccaaaacaggtggatatagtacagacgtgtattatcgaaatgaagaacaggcct
ggaaagcctctctttcatctggaacattacattgagggcaaatacatcaaatacaactca
aattctggatttgtgcgagacgacagcattcgtctaactccacaagccttcagtcacttc
acctttgagcgctcaggacaccagctcattgttgttgatatccagggagttggagatctt
tacacagaccctcagatccatacagagagtggtaaagattttggagatggcaacctaggt
gttcgaggtatggccttgttctttcattctcatttctgcaacaacatctgcaaaagcatg
gggcttgcaccatttgatctttcatccaaagagaaagatgccttggattataataaaaaa
ttgcttgaatctgctcaaacaattctccgtggcacagaggagaaatgcggcagcagccgg
gtgaggacggtgtccgggagccgccccccgctgctcttccgcctgtctgaaaactccggg
gatgaaagcatgagtgatgtggcatttgactccctgccctgctctccctcctctgcgacc
cctcacagccacaaggtggacatgcttaattggcctgtgttcagtgaagtagataacttg
gatcactttgacaacaaaagggattttgaaaatggtggagacagcggatgtcccagtgaa
aagagaagtgagacagaagatctggatcatagagagaggggccattcaaacaacaaccag
aagcaggagtctgatgaagacagtttgggaagctctgcaaggatcagtgtggagaagtgg
aatctttacaactcttccagagtccacatccacagaccatcctgtgttgcccaagaaatt
cagaggctcaatgcactagaacttgaaaagaaaattgggaagtcagtccttggaaaggtt
cacctggccatggttcgctatcatgaagccgggcggttctgtgagaaggacaaggaatgg
gatcaggagtcagccctgttccacctggagcatgctgcagactgtggggagctggaagcc
atcgttgggttaggcctcatgtgctctcagctgccacatcacatcctttccgaggtcact
ctcgaggatacaaaggagaacagaaataaaggatttaattacttgctgagagcagcagaa
gctggagaccggccttccatgattctggtagcaagagcatatgatacaggtgtaaatctt
ggtgcagacagagcccaggattggaaggaggcacttcactggtacaacgctgcgctgaac
atgaccgactatgatgagggaggtgaatatgatggcactcaggatgagccccggtatctg
ctcctggccagggaagcagagatgctaatgatgggagggttcaacctggataaggatcca
cagagatcaggtgagctttacacagaagcagcagaagcagccatggaagccatgaagggc
agactggcaaatcagtattaccaaaaagcagaagaggcttgggcgatgatggaagaatga

DBGET integrated database retrieval system