KEGG   Taeniopygia guttata (zebra finch): 100226105Help
Entry
100226105         CDS       T01082                                 

Gene name
PRKACB
Definition
protein kinase, cAMP-dependent, catalytic, beta
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100226105 (PRKACB)
   04310 Wnt signaling pathway
    100226105 (PRKACB)
   04340 Hedgehog signaling pathway
    100226105 (PRKACB)
   04020 Calcium signaling pathway
    100226105 (PRKACB)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100226105 (PRKACB)
   04210 Apoptosis
    100226105 (PRKACB)
  Cellular commiunity
   04540 Gap junction
    100226105 (PRKACB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100226105 (PRKACB)
   04912 GnRH signaling pathway
    100226105 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    100226105 (PRKACB)
   04916 Melanogenesis
    100226105 (PRKACB)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100226105 (PRKACB)
   04270 Vascular smooth muscle contraction
    100226105 (PRKACB)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100226105 (PRKACB)
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   100226105 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 398 aa AA seqDB search
MAGHTEVPCSQGSGTATALQRLEGFANRLFHRHSKNGAHEQRAALEGESQQCSEFTVQWD
KSMKEFLAKAKEDFLRKWESPPQNTAGLDDFERQKTLGTGSFGRVMMVKHKSTEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEA
PFIPKCRGPGDTSNFDDYEEEDIRASLTEKCAKEFADF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcagggcacacggaggtcccttgcagccagggctcggggacggccacggcgctgcag
agactggaagggttcgctaaccgcctcttccataggcactccaagaatggtgcgcatgag
cagagagcggctctggaaggtgagagccagcagtgctctgagttcactgtccagtgggac
aaatcaatgaaagagttcctagccaaagccaaagaagactttttaagaaaatgggaaagc
ccccctcagaatactgctggcctagatgattttgagcggcaaaaaacccttggaacagga
tcatttgggagagtaatgatggtgaaacataaatccacagaacagtattatgctatgaag
atactggacaaacagaaggtcgtcaaactgaagcagatagaacacacactgaatgagaag
aggatattacaagcagtgaactttcctttccttgttaaactggagtattcttttaaggac
aattctaatttatacatggtaatggagtatgttcctggtggagaaatgttttcacatcta
agaagaatcggaaggttcagtgaaccacatgcacggttttacgcagctcagatagtgcta
acatttgagtacctccattcattagacctcatctacagagatctaaagcctgaaaatctt
ttaattgatcagcaaggatacatccaggtcacggactttggctttgcaaaaagagtaaaa
ggcagaacttggacgttatgtgggactccagaatacctggcacctgaaataattctcagc
aagggttacaacaaggcagtggattggtgggcgctaggagtgttaatctatgaaatggca
gctggatatcccccattctttgcagatcagcccattcaaatttacgagaagattgtgtct
ggcaaggtgaggttcccatcacacttcagttcagacctaaaggatcttctaagaaattta
ctccaggtagatttgaccaaacgatatggaaatctcaagaatggtgtaaatgacataaag
aatcacaagtggtttgcaactacagattggattgccatttatcagagaaaggtagaagct
ccattcataccaaagtgcagaggtcctggagataccagcaactttgatgactatgaagaa
gaagatattcgtgcttctctaacagaaaaatgtgcaaaagaatttgctgatttttag

DBGET integrated database retrieval system