KEGG   Taeniopygia guttata (zebra finch): 100226301Help
Entry
100226301         CDS       T01082                                 

Gene name
EEA1
Definition
early endosome antigen 1
Orthology
K12478  
early endosome antigen 1
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Endocytosis
Phagosome
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100226301 (EEA1)
   04145 Phagosome
    100226301 (EEA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1A
AA seq 1408 aa AA seqDB search
MTYLVFETPGRGGSQSSDSDSSAAPGNAVDVNNEGSSEGFICPLCMKSHGSAEELFKHYE
AVHNSGIDSTHGGEGHLSPERDEVSLLRQEVQDLQASLKEERWYSEELKKELEKLQGQRQ
QESKSDGLTTATSTESLERQLEEIQVENFNIKQMKDLFEQKAAQLATEIVDLKSKYDEEI
SLREGAEQKVTNLRQELQKERSTVEDLKTELLQRPGVEDVAVLKKELVQVQTLMDKMTLE
RERESEKLKDECKHLQAEQANSEATINQLRAELAKGPQEVAVYVQELQKLQSSVKELEQK
NQSLTEKLLKKEEDYTQLEEKHNEVSVSKKNVQASFHQKDLDCQQLQAKLSASEASVQRL
QTELGEKAEASQKLKEELSEVETKYQHLKAECKQLQQQREEKEQHGLQLQSELSQLHSKL
LETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRAEEQLKEKAAISTELQHQL
EKAKQQHQEQQTLQQNTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKDNISLLE
KEREDLYAKIQAGEGETAVLNQLQEKNHALQIQVTQLTEKLKNQSESHKQAQENLHEQVQ
EQKAHLRAAQDRVLSLETNITELTSQLNESKEKVSQLDVQVKAKTELLLSAEASKAAQRA
DLQNHLDTAQNALQDKQQELNKVSAQLDQVTAKLNDKQEYCTQLEANLKEYKEKCLSLEQ
KTEELEAQLKKLEGDILNARASKDQALQELQQQRHQNKELDLHTAELSKQLEAAREAMSN
AQLDLQKKSEALDQANQQITKQEAEKASLKQNLEKSNQDTSKQLKELDCKMQAATSELQQ
VKLEKDTLLKDLTDTKDKLSKSSESFKKRKEELEKEIKKGKAAMAEMEKSCQELKHQLQI
QTESVAKERNELKNSLEKKEGISKQLSLDLDSARAQVLEIQGLLKEKEKSEQHLQGKLRE
LKESFEQKKKHSETLQAELKTALLEKAELENKLQQQSILSAQDLKAEKGKLADLQKAHDK
HKENMEKLQLDLYGKESELLATRQDLKSTEEKLALAQEELVSSRNRIASNNQQIQELKKA
KSALEQDASKKEQQLGEKTKMLQDLQNDRILKEKDLANEKCKTAELQEIRTRLENESAKL
GEELRACKQEFEKELTNLKDGNQLLIQQKLELQGKIDNANSTLEQEKQKHQAVKDQLKKR
EEELKKECAEIEAKLHTEKKDKEEEKRKHEEKETKLTMQVTALNENLATMKKEWQSSQRR
VSELEKQTDDLRGDNAVLEATVQNNQDERRALLERCIKSEGEIEKLQAKLVEMKKKLDNT
TAAMQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCA
ECSAKNALTPSSKKPVRVCDTCFNDLQG
NT seq 4227 nt NT seq  +upstreamnt  +downstreamnt
atgacttatttagtttttgagactccaggtagaggtgggtctcagagttcggattcagat
tcatctgccgcacccggaaatgccgtggacgtgaacaatgaaggctcctcagagggcttt
atttgtcctctctgtatgaagtctcatggatcagcagaggagctgttcaagcattatgaa
gcagttcataattctggcattgattcaactcatggaggggaaggtcatctgtcaccggaa
agagatgaagtatcactgctccgacaagaagtccaagacttgcaagcttcactgaaggag
gagagatggtattcagaagagctgaagaaagaactagagaaattgcaggggcagcggcag
caagaatctaaatctgatggattgacaacagctacgtctacagaatcattagaacggcaa
ctagaagagatccaagtagaaaattttaacattaagcaaatgaaagacttatttgagcaa
aaagcagcacaactggccactgaaattgtggatcttaaatcaaagtatgatgaagaaatc
agccttcgggaaggtgcagaacagaaagtgacaaatctgagacaagaactgcagaaagag
agaagtacagtagaagacttaaagacagaactgctacaaaggcctggtgtggaagacgtg
gctgtcctgaaaaaggagctggtccaagttcaaacactgatggataaaatgaccctggaa
cgtgaaagagaatctgaaaagctgaaagatgagtgcaagcacttgcaggctgagcaggct
aactctgaggctaccattaaccaattaagagctgaacttgccaaaggacctcaggaggta
gctgtgtatgttcaggagctgcaaaaacttcaaagttcagtcaaagagctagaacagaag
aatcagagtctgactgagaagctgctgaagaaagaagaggactacacccagctggaagaa
aaacacaatgaagtatctgtgagtaagaagaatgtgcaggcaagttttcaccagaaggac
ctggactgccaacagcttcaagcaaagctgtctgcgtctgaggcctcagtacagagatta
cagacagagctaggtgagaaggcagaagcaagccagaaacttaaagaagagctgtctgaa
gtagagacaaagtaccagcatctcaaggcagaatgtaaacagctccagcagcagagggag
gaaaaagaacagcatggcctgcaactccaaagtgagctcagtcagttgcacagtaaactc
ctagaaacagagcgccagttaggggaagcacacgggcggctcaaggaacagaggcagctg
tccagtgagaaactgatggacaaagagcagcaggtggctgacctacagttaaaactttct
cgtgctgaagagcagctaaaggaaaaagcagcaatttccacagaattgcaacatcaatta
gaaaaggcaaagcagcagcaccaggagcagcagacacttcagcaaaatacaacagcaaaa
ctacgagaagcccagaatgatctggagcaagtactacgacaaattggagataaggaccaa
aaaattcaaaatcttgaggctttgcttcagaaaagtaaggacaacatctctctgctagaa
aaggaaagagaggacttgtatgcaaaaattcaagctggtgaaggagaaactgcagttctt
aaccagctacaagagaaaaaccatgcattacaaatacaggtaactcagctgacagaaaag
ctgaaaaatcaatcagaaagtcataaacaagcccaagagaatttgcatgaacaagtgcag
gagcaaaaggcacacctaagagctgctcaagatcgtgtgctttccctagaaacaaacatc
actgaactaaccagtcagttaaatgaaagtaaagagaaagtgtcacaacttgatgtgcag
gtaaaagcaaagactgaattgctactttcagcagaagcatcaaaagctgctcagagagca
gatctacagaaccatctggacactgcccagaatgcactgcaagataaacaacaggagtta
aataaggtcagtgctcagctggatcaggttacagctaagctgaatgacaagcaggaatac
tgtactcagctggaagccaatcttaaagagtacaaagaaaaatgcctttctttagagcag
aaaactgaagaactagaggcacagcttaagaaacttgaaggtgacattcttaatgctaga
gcaagtaaagaccaagctcttcaggagctacagcaacagcgacatcagaacaaagaatta
gacctccacacagcagaactgagtaaacaacttgaagcagcaagagaagcgatgtctaat
gctcagctggatttgcagaagaaatctgaggcccttgaccaagcaaaccaacaaattaca
aagcaggaggcagaaaaggccagtctcaaacaaaaccttgagaaatcaaatcaagataca
agtaaacagctcaaggaacttgattgtaaaatgcaagcagccacatcagagctgcaacaa
gtgaagttagagaaggacactctattaaaggaccttacagataccaaagataagctctca
aaaagctctgaatccttcaaaaaaagaaaggaggaattagaaaaagaaattaaaaaagga
aaagcagctatggcagaaatggaaaaatcttgccaagaattaaaacaccagcttcagata
caaacagagtctgtagctaaagagaggaatgaattgaaaaactcactggagaagaaggag
gggatttctaagcagttgtctctagacctcgattcagcaagagcacaagtactggaaatc
cagggtcttctgaaggaaaaagaaaaaagtgagcaacatctccagggaaagctgagagag
ttaaaggaatcttttgagcagaagaaaaaacatagtgaaacactgcaagctgaattaaaa
actgcccttttagaaaaggcagagctggagaataaactacaacagcagtctattttgtca
gcacaggatcttaaagcagagaaaggcaagctagcagacttacagaaagcccatgacaag
cataaagaaaacatggagaaactacagctggatctttatgggaaagagtctgagctgctg
gcaaccaggcaggaccttaagtccacagaagaaaaacttgctttagctcaagaagaatta
gtttccagcaggaatcgaattgctagcaataatcaacagattcaggagctgaagaaggct
aagtctgcactggagcaggatgcatcaaagaaagagcagcagctgggtgagaagaccaaa
atgctgcaagatcttcagaatgacaggattttgaaagaaaaagatttggctaatgaaaaa
tgtaaaacggccgagctccaggaaataaggactagacttgaaaacgaaagtgccaagctg
ggtgaagagcttagagcctgcaagcaagaatttgagaaggagttgacaaatctcaaggat
gggaatcagctattgattcaacagaaattagaactgcagggcaaaatagataatgcgaat
tcaactctggaacaggagaaacaaaaacatcaagctgtcaaagatcagctgaaaaagaga
gaagaggagctgaagaaagaatgtgctgaaattgaagccaaactgcacacagagaaaaaa
gacaaagaagaggaaaaacggaaacatgaggaaaaagagaccaagctcaccatgcaggtc
acagccctgaatgaaaacctggctaccatgaagaaagagtggcaaagcagtcaaagacga
gtgagcgagctggagaaacagacagatgatttacgtggggacaatgctgtcttggaagca
acagtccagaataatcaggatgagagaagagcattgctggagaggtgtataaaaagtgag
ggagaaattgaaaagcttcaggccaagcttgtagaaatgaagaaaaagctggacaataca
actgctgcaatgcaggaacttggccgagaaaaccagtcattgcagatcaaacacacacaa
gctctcaacaggaagtgggcagaagacaatgaggtacagaattgtatggcctgtggaaaa
ggcttttcagtgacagtaagaaggcatcactgtagacagtgtggaaatatcttctgtgct
gagtgctcagcaaagaatgccttaactccttcttccaagaagcctgtccgagtctgtgat
acttgctttaatgacttgcaaggataa

DBGET integrated database retrieval system