KEGG   Taeniopygia guttata (zebra finch): 100226346Help
Entry
100226346         CDS       T01082                                 

Gene name
ST6GAL1
Definition
ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 (EC:2.4.99.1)
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100226346 (ST6GAL1)
   00514 Other types of O-glycan biosynthesis
    100226346 (ST6GAL1)
Enzymes [BR:tgu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     100226346 (ST6GAL1)
Glycosyltransferases [BR:tgu01003]
 Terminal extension
  Sialyltransferase
   100226346 (ST6GAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 413 aa AA seqDB search
MVHINVLKKFMCVLVVVLVALTVCLWRETRRNYYDPLKTRNDDLQGHRSLEKWNTVKSQG
LFHEAASELGQVSKTWLGTQNKVKGSTSETDEKSKKAVFGKVWDKDSSSRNLIPRLQKVR
KNYLAMNKYNVTYNGKRNAKLSPEQLLCQLRDRVNVTMIQRSDGPFGTSEWQQYLPGKSL
SEAVGHLGCCAVVSSAGSLKSSHLGQEIDSHDAVLRFNGAPVRGFQDDVGQKTTIRLVNS
QLVTVEEQQFLREPLYNTGILIVWDPAPYHAEIREWYRKPDYNFFESYKAYRRAHPEQPF
YILNPKMQWQLWDILQENSLEHIQPNPPSSGMLGIVLMMTLCDQVDVYEFLPSKRQTDIC
HYYQKFHDHACTMGAYHPLLFEKNLVKHMNQGTDEDIYTHGKVTLPGFRKVHC
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggttcacatcaatgtgttgaaaaagttcatgtgtgttcttgtggtggtcctggtagca
ctgacagtttgcctgtggagagaaacgagaagaaactactatgatcctttgaagaccagg
aatgatgatttgcaggggcacaggagtttggagaagtggaacactgttaaatcacaaggc
cttttccatgaagcagccagtgaactggggcaggtatccaaaacgtggcttggtacccaa
aacaaagtaaagggcagcacctctgagacagatgaaaagtccaagaaagcagtctttgga
aaggtatgggataaggacagttcatccagaaatctcatacccaggctgcagaaggtcagg
aaaaactacctggccatgaacaagtacaatgtgacttacaacgggaagaggaatgctaag
ctcagcccagagcagttgctgtgccagctgcgggacagagtcaatgtgaccatgatccag
aggtcggatggtccttttggtacctctgagtggcagcaatacctgccagggaaaagcctc
agtgaagcagtgggacacctgggttgctgtgctgttgtgtcctcagcagggtctctgaaa
tcatctcacctgggacaagagatagacagccacgacgccgtcttgcgcttcaatggggct
cctgtcaggggctttcaggatgatgtggggcaaaagacaacaattcgtcttgtgaattcc
cagcttgtaactgttgaagagcagcagttcctgagggaaccattatataacactggaatc
ttaattgtctgggatccagcaccatatcatgcagaaattcgtgagtggtacagaaaacca
gattacaacttttttgaaagctataaggcgtatcgtagagcacatccagagcagcccttc
tacatcctgaatcccaaaatgcagtggcaactctgggatattctgcaggagaattccctg
gagcatattcagcctaatccaccatcatcaggaatgcttggcatcgtgctgatgatgacg
ctgtgtgaccaggtggacgtgtacgaattcctgccctccaagcggcagacagacatctgc
cactattaccagaagttccacgaccacgcctgcaccatgggagcttaccaccccctcctg
tttgagaagaacttggtgaagcacatgaaccagggcacggatgaggacatctacactcac
ggcaaagtcaccctgcctggcttccgaaaagtgcattgctga

DBGET integrated database retrieval system