KEGG   Taeniopygia guttata (zebra finch): 100226448Help
Entry
100226448         CDS       T01082                                 

Gene name
MAP2K1
Definition
mitogen-activated protein kinase kinase 1
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Oocyte meiosis
Vascular smooth muscle contraction
Dorso-ventral axis formation
VEGF signaling pathway
Focal adhesion
Gap junction
Toll-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Influenza A
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100226448 (MAP2K1)
   04012 ErbB signaling pathway
    100226448 (MAP2K1)
   04370 VEGF signaling pathway
    100226448 (MAP2K1)
   04068 FoxO signaling pathway
    100226448 (MAP2K1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100226448 (MAP2K1)
  Cell growth and death
   04114 Oocyte meiosis
    100226448 (MAP2K1)
  Cell communication
   04510 Focal adhesion
    100226448 (MAP2K1)
   04540 Gap junction
    100226448 (MAP2K1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100226448 (MAP2K1)
  Endocrine system
   04910 Insulin signaling pathway
    100226448 (MAP2K1)
   04912 GnRH signaling pathway
    100226448 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    100226448 (MAP2K1)
   04916 Melanogenesis
    100226448 (MAP2K1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100226448 (MAP2K1)
  Development
   04320 Dorso-ventral axis formation
    100226448 (MAP2K1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100226448 (MAP2K1)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100226448 (MAP2K1)
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100226448 (MAP2K1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 395 aa AA seqDB search
MPKKKPGPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLIMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAIGRYPIPPPDSKELELMFGCPVEGDSPVTETSPRQRAPGRPMS
SYGSDSRPPMAIFELLDYIVNEPPPKLPNGVFGSEFQDFVNKCLIKNPAERADLKQLMIH
AFIKRSEAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagaagaagcccgggccgatccagctgaaccccgctccggatggatccgccgtg
aacgggaccagctctgcggagacgaatctggaggcgcttcagaagaagctggaggagctg
gagctggatgagcagcagcgcaagcgcctggaggcgttcctcacccagaagcagaaggtt
ggggagctgaaggatgatgactttgagaagatcagtgagctgggagcagggaatggtggt
gtggtcttcaaagtgtctcacaaaccctctggcctcataatggcaagaaagttaatccac
ctggagatcaagccagccatccgcaaccagatcatccgggagctgcaggtgctgcacgag
tgcaactccccctacatcgtgggcttctatggagccttctacagtgatggggagatctcc
atctgcatggagcacatggatggtggctccttggatcaagtgctgaaaaaggctgggagg
attccagaacagatcctgggcaaagttagcattgcggtaataaaaggactcacatatctg
agagaaaaacataaaataatgcacagagatgttaaaccatccaacattttggtaaactct
agaggtgaaatcaagctttgtgactttggtgtcagtgggcagctgatagattccatggca
aactcctttgttggcacacgctcctacatgtctcccgagaggctgcagggcactcactac
tcagtgcagtcagacatctggagcatggggctgtccctggtggagatggccattggcagg
taccccattccccctcctgactccaaggagctggagctgatgtttggctgccccgtggag
ggagattctccagtgacagagacctcgcccaggcaacgagcgcccggccgacccatgagc
tcctatggatcagacagcagacccccaatggcaatctttgaacttctggattacatcgtc
aatgagccacctccaaaactgcccaatggtgtctttggttctgaatttcaagattttgtt
aacaaatgtttaattaagaatcctgctgagagagccgacttgaagcagctgatgatccat
gctttcatcaagagatccgaggcggaggaggtggattttgcggggtggctctgctccacc
atcggccttaaccagcccagcacccccacgcacgccgccggcgtctga

DBGET integrated database retrieval system