KEGG   Taeniopygia guttata (zebra finch): 100226511Help
Entry
100226511         CDS       T01082                                 

Gene name
ITGB6
Definition
(RefSeq) integrin subunit beta 6
  KO
K06589  integrin beta 6
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04510  Focal adhesion
tgu04512  ECM-receptor interaction
tgu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100226511 (ITGB6)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100226511 (ITGB6)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100226511 (ITGB6)
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100226511 (ITGB6)
Cell adhesion molecules [BR:tgu04515]
 Integrins
  Integrin beta subunits
   100226511 (ITGB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt PSI_integrin Integrin_B_tail EGF_2 MMU163 DUF2970
Motif
Other DBs
NCBI-GeneID: 100226511
NCBI-ProteinID: XP_002193421
Ensembl: ENSTGUG00000006539
UniProt: H0Z879
Position
7
AA seq 789 aa AA seqDB search
MGIELLCLCFLFLLRNNYVQGTCSQESTVTCEDCLLSGPHCAWCLQENYTDSSGIHGRCD
TLENLLSKGCQLNFIEFPISEVEIHRNDPLTASSQKNGYDVTQISPQKLTLRLRPGHAET
IQIKVRQTEDYPIDLYYLMDLSASMDDDLNTIKELGSTLSKEMSKLTSNFRLGFGSFVEK
PVSPFIKTTAAEINNPCRSVPYECLPTFGYKNVLPLTNDAEKFNEIVKGQRISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGNCHLDHNNE
YSMSTVQEYPTIGQLIDKLVQNNVLLIFAVTNEQVHLYENYAKLIPGATVGRLQKDSGNI
LQLIIAAYQELRSEVELEILGETEGLNLSFTAICNNGTFFPHQRKCSHVKVGDTVSFNVT
VSLSSCDKTRRLIKIKPVGLSDMLEMEIHPLCSCNCQAKAEKKSPKCSQGKGSLECGVCV
CSPGYVGPRCECHESSLGASSCRGPAEHSSCSGRGDCYCGQCLCHPSPYGKVYGPRCECN
DFSCVRHRGLQCAGNGDCDCGECRCYSGWTGEYCNCTTDTSTCIAEDGTLCSGRGECICG
TCACTHPGALGQTCEKCPLCGDPCSSRWSCVECHLASDDKSLGDCSEKCKLVDATVSVAK
DYSEDKSISCSLQGENECITTFLLSVDEQGRTVIHSIERKDCAQHPNIPMIVVGVTLAIL
LIGIVLLCIWKLLVSLQDRKEVAKFEAEKSKVKWQTETNPLYRGSTTTFKNVTYKNQDMH
KRPMAADFY
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atggggattgaattgctttgcctctgtttcctattcctgctaagaaataactatgtgcaa
gggacctgttctcaggaaagcacagtgacttgtgaagattgtttgctttccggaccacac
tgcgcttggtgtttgcaagagaattacacagactcatctggaattcatgggaggtgcgac
accctggaaaatcttttgtccaaaggatgccagctgaatttcattgagtttcccatttca
gaagtagaaattcacagaaatgatcccctaactgcatcatcccagaagaacggttatgat
gtcacacagatttctccccagaaattaactctgaggctgcgaccaggacatgcagaaaca
atacagatcaaggttcgccagactgaagattatccaattgatctctactacctcatggat
ctttcagcttccatggatgatgatctgaatacaatcaaagaactgggttcaactctttcc
aaagagatgtcaaaactgacaagcaactttagactggggtttggatcttttgttgaaaaa
ccagtttcaccatttatcaaaactacagctgcagaaataaacaacccttgcagaagcgta
ccatacgagtgcttacccacttttggatataaaaatgttttgcccctaacaaatgatgct
gaaaaattcaatgaaattgtgaaaggacagagaatttctgctaatatagacactccagag
ggaggatttgatgcaatcatgcaggcagcagtttgcaaggaaaaaattggctggaggaat
gattctctacatttgctggtgtttgtgagtgacgctgattcccattttgggatggacagt
aaactggcagggattgttattcctaatgatgggaactgtcatttggaccacaataatgaa
tattccatgtcaactgttcaggagtatccaacaattggacaattaattgacaaacttgtg
caaaacaatgttcttttaatttttgctgtaacaaatgagcaagttcacttatatgagaat
tatgcaaagcttattcctggtgctaccgttggacgactacagaaggattctggaaatatt
ctccagttgatcattgctgcatatcaggagctgaggtctgaggttgaattggagatcctg
ggagagacggaagggctcaatctctccttcacagccatctgtaacaatgggacctttttt
ccacatcagaggaaatgctctcatgtgaaagtgggagatacggtctctttcaatgtgact
gttagtctctcttcttgtgacaaaaccagaaggcttatcaagataaaacctgtggggctc
agcgacatgctggagatggaaattcatcccctctgcagctgtaactgccaggccaaggcc
gagaagaagagcccgaagtgcagccaagggaaaggctccctggagtgcggggtgtgcgtg
tgcagccccggctacgtggggccgcgctgcgagtgccacgagagctccctcggggccagc
tcctgcaggggcccggccgagcacagctcctgcagcgggagaggcgactgctactgcggg
cagtgcctgtgccacccgtccccctacggaaaggtctacgggccccgctgcgagtgcaac
gacttctcctgcgtcaggcaccgcggcctgcagtgcgcaggcaatggtgactgtgactgt
ggggagtgcaggtgctacagtggatggactggtgaatactgtaattgcactactgatacc
agcacctgcattgctgaggatgggacactgtgcagtgggagaggtgaatgcatctgtggg
acatgtgcttgcacccatccaggggctttgggccaaacatgtgaaaaatgccctctctgc
ggtgacccctgcagctccagatggagctgtgtggaatgtcacttggcttctgatgacaag
tcactgggagattgcagtgaaaaatgcaaattggttgatgcaactgtcagcgtggcaaag
gattattcggaggataaatccatttcctgctctttgcagggggaaaatgaatgtataacc
acatttctactgtctgtggatgaacagggaaggacagtcattcacagcatagaacggaaa
gactgtgcacagcatccaaatatcccaatgatagtggtgggtgtcacccttgctatcctt
ctcattggcattgttttactttgtatatggaaattactggtgtcacttcaagaccgaaaa
gaggtggccaaatttgaagcagaaaaatcaaaagttaaatggcaaacggaaacaaatcca
ctgtacagaggctcaacaaccacttttaaaaatgtgacttacaagaaccaagatatgcat
aaaagacccatggctgcagatttctattag

DBGET integrated database retrieval system