KEGG   Taeniopygia guttata (zebra finch): 100226552Help
Entry
100226552         CDS       T01082                                 

Gene name
PFN2
Definition
profilin 2
Orthology
K05759  
profilin
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100226552 (PFN2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100226552 (PFN2)
Exosome [BR:tgu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100226552 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 91 aa AA seqDB search
MIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRV
LVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaggaaaagaccgagagggtttcttcaccaatggtctgacccttggtgcaaag
aagtgctctgtgatcagagatagcctgtatgtcgatggtgactgcacaatggacatcagg
acaaagagtcaaggtggtgagccgacatataatgttgctgtaggcagagctggacgagtc
ttggtctttgtaatgggcaaagaaggggtccatggaggcggattgaataagaaggcatac
tcaatggcaaaatacttgagagactctgggttctag

DBGET integrated database retrieval system