KEGG   Taeniopygia guttata (zebra finch): 100226660Help
Entry
100226660         CDS       T01082                                 

Gene name
PTPRR
Definition
(RefSeq) protein tyrosine phosphatase, receptor type R
  KO
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100226660 (PTPRR)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100226660 (PTPRR)
Protein phosphatases and associated proteins [BR:tgu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    100226660 (PTPRR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1A
AA seq 659 aa AA seqDB search
MRRRAATCLRALCLLLHLCAVGCFSGDSDHFLAIHQRKSGKPVFIYHHVESVEKSLDTDS
YKDSKQNFRSSSHTKISKLHPAIIVKSAFPRSVYDPSLNLLAMTGQDLEVENLPIPTTNV
IIVTLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIRKKNCVELFVSPLNTKPGI
SEALPSEEVLRSLNINILHQSLSQFGITEVSPEKNVLQGQREADKIWSKEGFYAVVIFLS
IFVILVTCLMVLYRLKEKIQLSLRQEKEKKQEIHLSPLPLQTSQTEYKTTNSMVQPQQAP
KVINVVVDSQGQCVPELKPPLCASPSPFRMKPVGLQERRGSNVSLTLDMSSLGSVEPFVT
VPTPREKVAMEYLQSAGRVLTRQQLRDTVSCSHLLQTEFMEIPMNFVDPKEIDIPSHGTK
NRYKTILPNPLSRVYLKPKNPSDSLSTYINANYIRGYGGKEKAFIATQGPMINTVNDFWQ
MVWQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVNSVQECKNYTVRQLTIKQG
SQSHSVKHYWYTSWPDHKTPDSAQPLLQLILDVEEDRLESLGRGPVVVHCSAGIGRTGCF
IATSIGCQQLKEEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALSLYERRLSAEAVQ
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgcggcggcgggcggccacctgcctccgggcgctctgcctcctgctccacctctgcgcc
gtaggctgcttttctggagatagtgatcactttttggcaattcatcagcgaaagagtgga
aaacctgtgtttatttatcaccatgtggagagtgtggagaaaagtttggatacagacagc
tataaggattccaaacaaaatttccgttcttcttcccacaccaaaataagcaagttgcac
cctgcaataattgttaaatcagccttccccaggtctgtttatgacccatccctcaatctc
ttagcaatgactggtcaagatttggaagtggagaatcttcccattcctacaacgaatgtg
attattgtgacactgcaaatggatgtaaacaagctgaatatcacattgcttcgtatattt
cgccaaggagtggcagcagcactgggactgttaccgcagcaagttcatatcaacagactc
attaggaagaagaactgtgtggaactgtttgtgtccccactgaacacaaagccaggaatt
tctgaggcgctcccatctgaagaagtactgcgttcccttaatatcaacattttgcatcag
agtttatcccagtttggaattacggaagtctcccctgagaaaaatgttttgcaagggcag
cgtgaagcagacaaaatctggagcaaagaaggattttatgctgttgtcatatttctcagc
atctttgtcattctagtgacttgtttaatggttctgtacagattaaaggagaagatccag
ttgtcactaaggcaagagaaggaaaagaagcaggagatccacctctcaccccttcccctg
cagacatctcagactgagtataagaccaccaacagcatggtccagcctcaacaagctcca
aaggttatcaatgttgtagtggactctcaaggccaatgtgttcctgagctcaaacctccc
ctgtgtgccagtccatctcctttcagaatgaaacctgtgggactccaggaaagacgagga
tccaatgtctcactaactttggatatgagcagcttgggaagtgttgaacccttcgtcact
gtgccaacaccacgagaaaaagtagcgatggaatacctgcagtcagctggccgcgtcctg
acacggcagcagcttcgagacacagtttcatgttctcatttacttcaaacagaattcatg
gaaataccaatgaattttgtggatcccaaagaaattgacatcccaagtcatggaactaaa
aaccgctataaaacaattttgccaaatcctctaagcagagtgtatttgaaaccaaaaaat
ccatctgattccttgagtacctacataaatgctaactacattaggggatatggaggtaaa
gagaaggctttcattgcaactcagggacccatgattaataccgtgaatgatttctggcag
atggtttggcaagaagacagccctgtcattgttatgatcacaaagctgaaagaaaaaaat
gagaaatgtgtgctttattggccggagaaaagaggaatctatgggaaggttgaagtcctt
gttaacagtgtgcaagaatgcaaaaactacactgtccgtcagcttacaataaagcaaggg
agtcagtcccacagtgtgaagcactactggtacacatcctggccggaccacaaaaccccc
gacagtgctcagcctctgctgcagctcattctggatgtggaagaggacaggctggaatca
ctgggcagagggcctgttgttgtgcactgcagtgctggtataggaagaactggatgtttt
attgccacatccattggttgtcagcagttaaaggaagagggagttgtagatgcattgagc
attgtctgccagctacgagtggatcggggtggaatggttcagaccagcgagcagtatgaa
tttgtgcaccatgcactgagtctgtatgaaagaagactttctgcagaagctgtccagtga

DBGET integrated database retrieval system