KEGG   Taeniopygia guttata (zebra finch): 100226672Help
Entry
100226672         CDS       T01082                                 

Gene name
CYLD
Definition
(RefSeq) cylindromatosis (turban tumor syndrome)
  KO
K08601  
ubiquitin thioesterase CYLD [EC:3.4.19.12]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100226672 (CYLD)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100226672 (CYLD)
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C67
   100226672 (CYLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 951 aa AA seqDB search
MNSGLWSQEKASSSYWEERIFYLLLQECSVIDKQTQKLLKVPKGSIGQFFQDRSSVAHSR
NIPCKGKKLQIGLKILEQPHAVLFVDEKDVIEINEKLAELLLAITNCEERYSLFKSKSRL
AKGVQIDIGSPVRVQLRSGDEKYPGVVRFRGPLMQERSLTGIYFGVELLEEGRGQGFTDG
QYQGKQLFRCDEDCGVFVALDKLELVEDDDNELESDYAAPVDAMQVELPPLEINSRVSLK
IGESIEYGTVIFCDVLPGNESLGYVVGVDMDNPIGNWDGRYNGIQLCSFASVESTLLLHI
NDVIPETVSQDRRPPKLAYTSRSGDKGLFNHSKPKAIGSTSEPGNRSRSEVFYTLNGSSV
DSQPQTKTKSPWYIDEAAEDPSKSLTDSSPGFGHSSPPLQPPLTNSVSTENRFHSLPFSL
TKTTSTNGTIGHSPLSLSVQSVMGDVNTTATQESPSTASPIGNSHGLEAGSLAEVKENPP
FYGVIRWIGQPPGVNEVLAGLELEDECAGCTDGTFKGTRYFTCAPKKALFVKLKSCRPDS
RFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLETMIGKKKGIQGHYNSCYL
DSTLFCLFSFSSVLDTVLLRPKEMNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLR
KILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMDKNE
KVGVPTIQQLLEWSFINSNLKFAEYPGCLVIVLLHFHIPFVKNQSLPSLETNTFVATAAP
RQCRICRGLAMYECRECYEDTDISAGKIKQFCKTCNTQVHLHPKRQSHKFNPLSLPKDLP
DWDWRHGCIPSQKMELFAVLCIETSHYVAFVKYGRDDSAWLFFDSMADRDGGQNGFNIPQ
VTPCPEVGEYLKMSLEELHSLDSRKIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaggcttatggagtcaagaaaaagcaagttcatcctattgggaagagcggatc
ttttacttgcttctccaagaatgcagtgtcatagacaagcagactcaaaagctcttgaaa
gtgcccaaaggtagcattgggcagttttttcaagaccgttcttctgtggcacactccaga
aatattccatgtaaaggcaagaaactacagattggattaaagattctggaacaacctcat
gcagtcttgtttgtggatgagaaggatgttatagaaataaatgaaaaactagctgagttg
cttctggctattactaactgtgaggaaagatacagtttgtttaagagcaaaagcaggtta
gctaaaggagtccagatagatattggctcacctgttagagtacaactgagatcaggggat
gagaaatatcctggagttgttcgcttcaggggacccttaatgcaagaaaggtccctaaca
gggatatactttggagtagagttgctggaagaaggtcgtggtcagggctttactgatgga
cagtaccaaggcaagcagcttttcagatgtgatgaggattgtggggtttttgttgctttg
gacaaactggagctggtggaagatgatgacaatgaactggaaagtgactatgcagctcca
gttgacgcaatgcaggtagaacttcctcctctggagatcaactccagggtttctctgaag
ataggagagagtatagagtatggcacagttatattctgtgatgtcttaccaggaaacgaa
agtttaggatacgttgttggagtggacatggataatccgattggaaactgggatggaaga
tataatggaatacagctgtgcagttttgcaagtgttgaaagtacacttcttttgcatatc
aatgatgttattccagagacggtgtcacaggacaggagacctcccaagcttgcctatacc
tcaagaagtggtgacaaaggcttgttcaatcatagtaagccaaaggctataggatctacc
tctgaacctggaaatagaagcagatctgaagtgttctacacattaaatggctcatcagtt
gactctcagcctcaaacaaaaacaaaatccccatggtatattgatgaagctgctgaagac
ccttcaaagtcacttactgattcatctcctggatttgggcattcttcaccaccactgcag
ccacctttaacaaattctgtgtctacagaaaacagatttcactccctcccctttagcttg
acaaaaacaacaagtactaatggtactattggacatagtcctctctctttatctgttcag
tctgtcatgggtgatgtgaatactacagctacccaggagagtccatcaacagcaagccca
attggaaactcacatggtcttgaagcaggttccttggctgaagttaaagaaaatcctcct
ttctatggagtaatccgctggattggccagccccctggagtaaatgaagtattagcagga
ctggaactggaagatgaatgtgcaggctgcacggacgggacatttaaaggaactcgatac
ttcacgtgtgctccaaagaaagctctttttgttaaactcaaaagctgcaggccggattcc
aggtttgcctcgctccagcctgtttccaaccagatcgagcgctgcaactctctagccttt
ggaggttacttaagtgaagtggtagaagaaaacactcctccaaaaatggaaaaagaaggt
ttagagacaatgattggaaagaagaaaggtatccagggtcattacaactcctgttactta
gactccaccttattctgcctgttttcttttagctctgttttggacactgtgctactcaga
cctaaagaaatgaatgatgtagagtattatagtgagactcaggagctgctgcggacagag
attgtgaatcctctgagaatatatggatatgtatgtgctaccaaaataatgaaactgagg
aaaatacttgaaaaagttgaggctgcatcaggattcacttcggaggaaaaagatccagaa
gaatttttgaatattttatttcaccatattctaagagttgagccactgttgaaaataaga
tcagcaggtcagaaagtacaagactgttacttctatcagatttttatggacaaaaatgag
aaagttggagtcccaacaattcagcagttactggagtggtcattcatcaacagcaacttg
aagtttgcagagtatcctggttgtttggtaatagttctccttcattttcatattcctttt
gttaaaaatcaaagcctccccagcctggagactaatacctttgttgccactgcagctccc
aggcagtgccgtatctgcagagggctcgctatgtacgagtgcagggagtgttacgaagac
actgatatttctgctggcaaaatcaagcaattctgcaaaacatgcaatacacaggttcat
cttcatcccaagagacagagtcataaattcaatccgttgtcacttccgaaggacctgcca
gactgggactggcggcacggctgcatcccctcgcagaagatggagctgtttgcagtgctg
tgcatcgagaccagccactacgtggccttcgtcaagtacggcagggacgactcggcctgg
ctcttcttcgacagcatggcagatcgggatggaggtcaaaacggctttaacattccacaa
gttaccccgtgtccagaagttggtgaatacctgaagatgtctctagaagaattgcactca
ctggattccaggaaaatccaaggttgtgcacgaagactgctttgtgatgcttacatgtgc
atgtatcaaagtccaacgatgagtttatacaaatga

DBGET integrated database retrieval system