KEGG   Taeniopygia guttata (zebra finch): 100226768Help
Entry
100226768         CDS       T01082                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100226768
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100226768
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100226768
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100226768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 217 aa AA seqDB search
IPILQAAQAVAKRPLSLYASPWTSPVWMKTNGAMTGRGTLKGSPGDKYHRAWAKYFIRFL
DEYAKHNLTFWAVTAGNEPTAGEIIFYPFQCLGFSPEHQRDFIAQDLGPALANSSHRHVQ
LIILDDQRVMLPYWAEVVLKDPVAASYISGIGIHWYLDFLAPIDLTLSITHHLFPDYFLL
STEASAGSYFWEDAHTEGECGSCRDTERTSADATLPG
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atccccatcctccaagcagcccaggcagtggccaagcggccgctgtcgctctatgccagc
ccttggacctccccggtgtggatgaagacgaacggagcaatgacagggagggggacactg
aagggcagccctggggacaagtaccaccgggcctgggccaagtactttatccgcttcctg
gatgaatacgccaagcacaacctgaccttctgggcagtgacagcagggaacgagcccacg
gctggggagatcatcttctaccccttccagtgcctgggcttctcccctgagcaccagcgg
gacttcatcgctcaggacctgggcccggcgctggccaacagctcccaccgccacgtccag
ctcatcatcctggatgaccagagggtgatgctgccctactgggccgaggtggttctcaaa
gaccctgtggctgccagttacatcagcggcatcggcatccactggtacctggattttctg
gcacccattgacctgacgctctccatcacccatcacctcttcccagactatttcctcctc
tccacggaggcctccgcaggctcctatttctgggaggacgctcacacggaaggggaatgt
ggttcctgcagggacacggagcggaccagtgctgatgccacgctcccagggtaa

DBGET integrated database retrieval system